KEGG   Leishmania braziliensis: LBRM_10_0310Help
Entry
LBRM_10_0310      CDS       T01113                                 

Definition
(RefSeq) putative isocitrate dehydrogenase [NADP],mitochondrial precursor
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00020  Citrate cycle (TCA cycle)
lbz00480  Glutathione metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
lbz01210  2-Oxocarboxylic acid metabolism
lbz01230  Biosynthesis of amino acids
lbz04146  Peroxisome
Module
lbz_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBRM_10_0310
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBRM_10_0310
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LBRM_10_0310
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LBRM_10_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5413284
NCBI-ProteinID: XP_001562802
UniProt: A4H612 A0A3P3YZJ2
Position
10:116720..118027
Genome map
AA seq 435 aa AA seqDB search
MFRRVSAASASSLVAVRAFSSTNVCLGKRIKVKNEVVDMDGDEMTRIIWSLIKEKLILPY
VDVPINYFDLSVTHRDATNDKVTVDAAEAIMKCNVGIKCATITPDESRVTEFNLKKMWKS
PNGTIRNILGGTVFREPIIVSNIPRIVKHWKEPIVVGRHAFGDQYKATDTIYKPGKLQLV
HTPADGSAPTTLDVYDFKSEGVGMAMYNTKKSIEGFAKSCFQYALMRKYPLVLTTKNTIL
KKYDGVFLQTFQRMYEEQYKSDFEKAGITYNHRLIDDQVAQMIKGEGGFVWACKNYDGDV
QSDIVAQGFGSLGLMTSVLMCPDGKTIEAEAAHGTVTRHYRQHQQGKETSTNSIASIYAW
TRGLAHRGKLDGNCDLVKFSDMLEKVVIKTVEDGHMTKDLALCVHGSSGVKREQYETTEE
FLNSVDAALKKAMCA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtcgtgtttcagctgcttcggcgagctctctcgtcgccgtccgcgccttctcc
agcactaatgtctgcctgggcaagcgcatcaaggtcaagaatgaggtggtagacatggac
ggcgacgagatgacgcgcattatctggtcgctcatcaaggaaaagctgatcttgccctac
gtggatgtcccgatcaactacttcgacctcagcgtgacccaccgtgacgcgacaaatgac
aaggtcaccgtcgacgccgccgaggcgatcatgaagtgcaacgtcggcatcaagtgcgcc
acgatcaccccggatgagtctcgcgtgacggagttcaacctaaagaagatgtggaagagc
ccgaatggcaccatccgcaacatcctcggcgggacggtgttccgtgagccgatcatcgtc
tccaacatcccacgcatcgtaaagcactggaaggagccaattgtggtcggccgtcacgcc
ttcggcgatcagtacaaggcgacggacaccatctacaagccgggtaagctgcagcttgtg
cacacacccgctgacggcagcgcgccaacgacgctggacgtctacgactttaagagcgag
ggtgtgggcatggccatgtacaacacgaagaagagcatcgaaggcttcgcgaagagctgc
tttcagtatgcgctgatgcgcaagtacccgctggtgctgacgacgaagaacaccatcctg
aagaagtacgacggcgtgttcctgcagaccttccagcgcatgtacgaggaacagtacaag
tccgacttcgagaaggcaggcatcacatacaaccaccggctcatcgatgaccaagtcgcg
cagatgattaagggcgagggcggcttcgtgtgggcgtgcaagaactatgacggtgacgtg
cagagcgacatcgtggcacagggtttcggctcgctgggcctcatgacatccgtgctcatg
tgcccggatggcaagacgatcgaggcagaggccgcccacggcacggtgacgcgtcactac
cgccagcatcagcagggtaaggagacgagcacaaactccatcgcctccatctacgcctgg
acgcgcggcctcgcccatcgtggtaagctggacggcaactgcgaccttgtgaagttctcg
gatatgctggagaaggtcgtcatcaagacggtcgaagatggtcacatgacgaaggacttg
gccctctgtgttcacggctccagcggcgttaagcgcgagcagtacgagacgaccgaggag
ttcctcaatagcgtcgatgccgctctgaagaaggcgatgtgcgcgtaa

DBGET integrated database retrieval system