KEGG   Leishmania braziliensis: LBRM_13_0240Help
Entry
LBRM_13_0240      CDS       T01113                                 

Definition
(RefSeq) putative long-chain-fatty-acid-CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00061  Fatty acid biosynthesis
lbz00071  Fatty acid degradation
lbz01100  Metabolic pathways
lbz01212  Fatty acid metabolism
lbz04146  Peroxisome
Module
lbz_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LBRM_13_0240
   00071 Fatty acid degradation
    LBRM_13_0240
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LBRM_13_0240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lbz01004]
    LBRM_13_0240
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbz04147]
    LBRM_13_0240
Enzymes [BR:lbz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     LBRM_13_0240
Lipid biosynthesis proteins [BR:lbz01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   LBRM_13_0240
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   LBRM_13_0240
  Exosomal proteins of breast cancer cells
   LBRM_13_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C FeoA
Motif
Other DBs
NCBI-GeneID: 5413661
NCBI-ProteinID: XP_001563167
UniProt: A4H731 A0A3P3Z0S3
Position
13:complement(86802..88811)
Genome map
AA seq 669 aa AA seqDB search
MLQRFSRRSLRGYRGAQQVAALRCSLRFGMNVGGSYYQESDTAGIHQMNNDLRLGLVIKP
QSTLVELWEQALKAWPTRRFLGSKMWVRGKLGYVWATYESINTEVEAMRTLLHQMGVEKG
SRVVVISENRYEWVVVHFATMQLGAHFVALPTNITPSEAQLVVRSTQSKVLFVETKASYA
AVKGWIGRVGQLEHAICFEDQVGEGSYAVAISIAADVPEKTPARTDVRAEDTAMIVFTAG
TTGPPKGVMLSHKNIVANVSSVYASLGEALTHSDMFMSLCSWCVAGSLTADLYQALCKGA
CVCIPPETLEGFQDLPLVNPSVIVSVAQPFQRAYANIVDDILNRGSFTKDLTRLVVGRIT
ENRLMFKKPGRTLRAFSHALLGKFKAQFGSELRVVIIIGHQLTKDQSELMADLDVFVVNT
YGCMEAGGLIATDVDVPQRLKALPGLEVRVVNEKNEIVAPGDLGEILVEAPNAMQGYFDV
HIDPEEAKNSLVEYGSRTFVRSGDYGTLTGGWITVRGNKDVLIKLANAKTVNPLEVEATL
TKSPFIKQVFIYGNGRPYVVALVVANTKAIAAHLRKVERRDGIPLVNDREKADCIRAELR
RVSQDLPPRTHVRRFAFVDEFTLANGFMTVKMGYARQKIEDHYVHYFEALYDETPKFYGF
AVDDYDDLF
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagcgtttctctcgtcggtcgttacggggctaccgcggcgcgcagcaggtggca
gcgctgaggtgctcgctgcgattcggcatgaatgttggcggatcgtactaccaggagtcg
gatacggccgggattcatcagatgaacaacgacctccggctgggccttgtcatcaagccg
cagagcacgctcgtggagctgtgggagcaggcgctgaaggcatggccaacccgccgcttt
ctggggagcaagatgtgggtgcgcggcaagcttggctacgtctgggccacgtatgagtcc
atcaacactgaagttgaggcgatgcggacactgctacatcagatgggcgtcgagaaggga
tctcgtgttgtggttattagcgagaaccgctatgagtgggttgtggtacacttcgccacc
atgcagctgggggcgcactttgtggcgcttcccaccaatatcaccccgtccgaggcgcag
ctcgtggtgaggagcacacagtccaaggttctctttgtcgagacaaaggcgtcgtacgca
gcagtcaaggggtggattggtcgtgtggggcagcttgagcacgccatttgttttgaggat
caggttggggagggcagctatgcagttgcgattagcattgcggcagacgtgcctgagaaa
actcctgcgcgaacggacgtccgtgctgaggacaccgcgatgattgtcttcacagctggc
accacggggccgccaaagggtgtcatgttgtctcacaagaacatcgttgcgaacgtcagc
tctgtgtatgctagccttggcgaggcgctgacgcacagcgacatgttcatgtcgctgtgc
tcgtggtgcgttgcgggcagcctaacggcagacttgtatcaggcactgtgcaaaggcgcg
tgcgtgtgcatcccccctgaaaccctggagggattccaagacttaccccttgttaacccg
agcgtcattgtctctgtggcgcagccctttcagcgcgcgtacgcgaacatcgtcgacgac
atattgaaccgtggtagcttcaccaaggacctcacccgcctcgtcgtcggtcgcatcacc
gaaaaccgtctcatgttcaagaaaccgggccgcacactccgggccttctcccacgctctg
ctcggcaagttcaaggcacagtttggctcggagttgcgcgtcgtcatcattatcggccac
cagctcaccaaggatcagtcagagctcatggcggacctggatgtgtttgtggtgaacacg
tacggctgcatggaggcgggtgggctcatcgccaccgatgtggatgtgccgcagcgtctc
aaagctttgcccggtcttgaggtgcgcgtcgtaaacgagaaaaacgagattgtggcgcca
ggggacttgggcgagatcctcgtagaggcccccaacgccatgcagggctactttgacgtg
cacatcgacccagaggaggcgaagaattcgctggtggagtacggaagccgcacctttgtg
cggtccggcgactacggcaccctcaccggaggatggataacggtgaggggcaacaaagac
gtcctcatcaagttggcgaacgccaagacggtgaacccgctcgaggtggaggcgaccctg
acaaagagcccgttcattaagcaggtcttcatctacggaaatggtcgcccttacgtcgtg
gcactcgtggtggccaacactaaggccatcgccgcacacttgcgcaaggtggagcgtcga
gatggtataccgctcgtcaacgatagggaaaaggctgattgcatccgcgccgagctgcgg
cgcgtctcgcaggacttgccccctcgcactcacgttcgccgctttgcctttgtggacgaa
tttaccctcgccaacggcttcatgacggtgaagatgggctacgcacgccaaaagatcgag
gatcactacgtgcactactttgaggccttgtacgatgagacgccgaagttttacgggttt
gctgttgatgactacgatgacttgttctag

DBGET integrated database retrieval system