KEGG   Leishmania braziliensis: LBRM_16_1370Help
Entry
LBRM_16_1370      CDS       T01113                                 

Definition
(RefSeq) putative cytochrome c
  KO
K08738  cytochrome c
Organism
lbz  Leishmania braziliensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-GeneID: 5414261
NCBI-ProteinID: XP_001563739
UniProt: A4H8R0
Position
16:complement(522552..522893)
Genome map
AA seq 113 aa AA seqDB search
MPPKARAPLPPGDVERGEKLFKGRAAQCHTATKGGSNGVGPNLFGIVNRKSGTIEGFAYS
KANADSGVIWTPEVLDVYLENPKKFMPGTKMSFAGIKKPQERADVIAYLETLS
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgaaggctcgtgctcccctcccgcctggtgatgtggagcgtggtgagaagctg
ttcaagggtcgcgctgcccagtgccacaccgccaccaaaggaggttctaacggcgtgggc
ccgaacctgtttggcattgtcaaccgaaaatctggcacgatcgagggctttgcgtacagt
aaggcgaacgctgactctggcgtgatctggacgccggaggtgctggacgtgtacctggag
aacccgaagaagtttatgcctggcacgaagatgtcgttcgctggcatcaaaaagccgcag
gagcgcgctgacgtgattgcatacctcgagactctgagttaa

DBGET integrated database retrieval system