KEGG   Leishmania braziliensis: LBRM_20_4190Help
Entry
LBRM_20_4190      CDS       T01113                                 

Definition
(RefSeq) PGKC, phosphoglycerate kinase C
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
lbz01230  Biosynthesis of amino acids
Module
lbz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbz_M00002  Glycolysis, core module involving three-carbon compounds
lbz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_20_4190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbz04147]
    LBRM_20_4190
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     LBRM_20_4190
Exosome [BR:lbz04147]
 Exosomal proteins
  Proteins found in most exosomes
   LBRM_20_4190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK
Motif
Other DBs
NCBI-GeneID: 5415250
NCBI-ProteinID: XP_001564699
UniProt: A4HBH9
Position
20_and_34a:complement(1597373..1598812)
Genome map
AA seq 479 aa AA seqDB search
MTLVQKKSIDDATLKGKKVLIRVDFNVPVKNGKITNDFRIRAALPTIQKVLKEDGSCILM
SHLGRPKGAKMSDPKPAKGVRGYEEAATLRPVAERVAELLGRKVEFAPDCLDAALYVSKL
KGGDVLLLENVRFYTEEGSKKEEERDAMAKVLASYADVYISDAFGTAHRDSATMTGIPKV
LGAGYAGYLMEKEINYFARVLNNPPRPLVAIVGGAKVSDKIQLLDNMLDRINFLVIGGAM
AYTFQKAQGYKIGISMCEEDKLDLAKSLLKKAQERGVQVLFPVDHVCHKEFKAVESPLVT
EGVDIPDGYMALDIGPKTIRMYEDVIGRCNSAIWNGPMGVFEMACYSKGTFAVAKAMGAG
TQKNGLMSIIGGGDSASAAEMSGEAKNMSHVSTGGGASLELLEGKTLPGVAVLTDKIVKE
RAASSKGSFGGSSSRRESAPRRSGCAFGGASIVVEIIKLLGALAIGIFIGRRMSTKLLQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgactcttgtgcagaagaagagcatcgatgatgctaccctcaagggaaagaaggtgctc
atccgcgtggacttcaacgttcccgtgaagaacgggaagatcacgaacgacttccgcatc
cgcgccgcccttccgacgatccagaaagtgctgaaggaggatggctcctgcatcctgatg
agccaccttggccgcccgaagggtgctaagatgagtgacccaaagccagcgaagggtgtg
cgcgggtacgaggaggccgccaccctgcgcccggtcgctgagcgcgtcgcagagctcctg
gggcggaaggtggagtttgcacccgactgcctggatgctgcgctgtatgtgtcaaagcta
aagggtggcgacgtgctgctgctcgagaatgtgcgcttctacacagaagagggcagtaag
aaggaggaggagcgcgacgcgatggcgaaggtactggcatcatacgcggacgtgtacatc
agtgatgcctttggtactgcgcaccgcgacagtgcgacgatgacagggatccccaaggtg
cttggtgcgggctacgccgggtacctgatggaaaaggagatcaactattttgcgcgagtg
ctgaacaacccgccgaggccgctggttgcgattgttggtggcgcgaaggttagcgacaag
atccaactgcttgacaacatgctggaccgcatcaacttccttgtgattggtggcgcgatg
gcgtacacgttccagaaggcgcagggatacaagatcggaatctcgatgtgcgaggaggat
aagctggaccttgccaagtcgctgttgaagaaagcgcaggagcgcggcgtgcaggtgctt
tttccggttgaccacgtgtgccacaaggagttcaaggctgtggagtcaccgctggtgacg
gagggcgtggacattccggatggctacatggcgctcgacattggtccgaagacgatccgc
atgtacgaggatgtgattggccgctgcaatagcgcgatctggaatggtccgatgggcgtg
ttcgagatggcatgctactcgaagggtacgttcgctgttgcgaaggcgatgggagctggc
acgcagaagaatgggctgatgagcatcatcggcggtggcgacagcgcgagcgctgcagaa
atgagcggcgaggcaaagaatatgtcgcatgtatccaccggaggcggtgcgtcgctggag
ctgctggagggcaagacgctgcctggcgttgccgttctcacggataagattgtgaaggaa
cgggcagcttcgagcaagggctcttttgggggttctagttcgcgtagggagtctgctccg
cgccgttccgggtgtgccttcggaggtgcctcaatcgtagtggagatcattaagctcctc
ggtgcactggcgattggaatctttattggtcgccgcatgagcaccaaactgctccagtag

DBGET integrated database retrieval system