KEGG   Leishmania braziliensis: LBRM_20_5360Help
Entry
LBRM_20_5360      CDS       T01113                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz00051  Fructose and mannose metabolism
lbz00562  Inositol phosphate metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
lbz01230  Biosynthesis of amino acids
Module
lbz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbz_M00002  Glycolysis, core module involving three-carbon compounds
lbz_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_20_5360
   00051 Fructose and mannose metabolism
    LBRM_20_5360
   00562 Inositol phosphate metabolism
    LBRM_20_5360
Enzymes [BR:lbz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LBRM_20_5360
Exosome [BR:lbz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LBRM_20_5360
  Exosomal proteins of bladder cancer cells
   LBRM_20_5360
  Exosomal proteins of melanoma cells
   LBRM_20_5360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 12983436
NCBI-ProteinID: XP_003723085
UniProt: E9AIG9
Position
20_and_34b:complement(423752..424507)
Genome map
AA seq 251 aa AA seqDB search
MSDKPQPIAAANWKCNGTTASIEKLVQVLNEHHISHDVQCVVAPSFVHIPLVQAKLCNPK
YVISAENAIAKSGAFTGEVSMPILKDLGVNWVILGHSERRTYYGETDEVVAQKVSDACLQ
GFMVIACIGETLQQREANLTAKVVLGQMAAIAAKLPKKAWGQIVLAYEPVWAIGTGKVAT
PEQAQEVHALLRKWVSEKIGADVAAKLRILYGGSVSASNAKTLYMKHDINGFLVGGASLK
PEFREIIDATQ
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaagccgcagccgatcgccgccgccaactggaagtgcaacgggaccaccgcc
tccatcgagaagctggtgcaggtcctcaacgagcaccacatcagccatgacgtgcagtgc
gtcgtggcgccatcctttgtgcatatcccgctggttcaggccaagctctgcaaccccaag
tacgtcatcagcgctgagaacgcgatcgccaagagcggcgccttcacaggtgaggtgtct
atgccgatattgaaggacctgggcgtcaactgggtcattcttggccactcggaacgccgc
acctactacggtgagacggacgaggtcgtagcacagaaagtttcggatgcctgcctgcag
ggcttcatggtgattgcttgcatcggggagacgctgcagcagcgtgaagcgaacctgaca
gcgaaggtggtactgggtcagatggcggcgatcgccgcgaagctgccgaagaaagcgtgg
ggccaaatcgtgctggcctacgagcccgtgtgggccattggtaccggcaaggtcgccacg
cccgagcaggcacaggaggtccacgcgcttctgcgcaagtgggtaagcgagaagattggc
gccgacgtcgccgcgaaactccgcatcttgtacggcggctccgtcagcgccagcaatgcc
aagacgctctacatgaagcacgatattaacggttttctggtcggtggcgcgtccctcaag
ccggagttccgcgaaattatcgatgccacccagtga

DBGET integrated database retrieval system