KEGG   Leishmania braziliensis: LBRM_25_1710Help
Entry
LBRM_25_1710      CDS       T01113                                 

Definition
(RefSeq) putative succinyl-CoA synthetase alpha subunit
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00020  Citrate cycle (TCA cycle)
lbz00640  Propanoate metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LBRM_25_1710
   00640 Propanoate metabolism
    LBRM_25_1710
Enzymes [BR:lbz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     LBRM_25_1710
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LBRM_25_1710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5416260
NCBI-ProteinID: XP_001565675
UniProt: A4HEB6 A0A3P3Z8W7
Position
25:complement(631704..632606)
Genome map
AA seq 300 aa AA seqDB search
MFARSAIRRWINKDTKLIVQGMTGKAGSFHTKAAMAYGTKVVGGVSPKKAGTTALGVPVF
ATTAEAVKATGATASVLYVPAPLCAASIEEALEAEVPLVVVITEGIPQWDMLRVKSMLLS
QNKTRLIGPNCPGIIKPGECKIGIMPGHIHQKGKIGIVSRSGTLTYEAVAQTTAVGLGQS
LCVGIGGDPFNGTNMVDCLRLFLNDPETEGIILIGEIGGTAEEEAADFIKNSPIKKPTVS
FIGGATAPPGRRMGHAGAIVSGGMGTAKGKKEALRAAGVTVSDSPAHLGKHMAELFATKA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcccgctccgccatccgccgctggatcaacaaggacacgaagctgattgtccag
ggcatgaccggcaaggccggctctttccacacgaaggcggcgatggcgtacggcaccaag
gtcgtgggcggcgtgagcccgaagaaggcgggcacgactgcgctgggggtgccggtgttc
gcgacgaccgcggaggcggtgaaggcgacgggcgcgactgcgtctgtgctatacgtgcct
gcacctttgtgcgcggcgtcgatcgaggaggctctggaggcggaggtgccgctggttgta
gtgatcacggagggcatcccgcagtgggacatgctgcgcgtgaagtcgatgctgctgtca
cagaacaagacgcgcctgatcggccccaactgcccaggcatcatcaagcctggggaatgc
aagatcggcatcatgcccggccacatccaccagaagggcaagatcggcattgtgtcacgc
agcggcacgttgacgtacgaggcggttgcgcagacgacggcggtgggcctcggccagtcg
ctgtgcgtcggcattggcggcgacccgttcaacggcacgaacatggtggactgcctgagg
ctgttcctgaatgaccccgagacggagggcatcatcctgattggcgagatcggcggcacg
gcagaggaggaagcggcggacttcatcaagaacagtccgatcaagaagccgaccgtgtcc
ttcatcggtggggcgacggcgccgccgggccgccgcatgggccacgccggcgccatcgtg
tctggcgggatgggcaccgcgaagggcaagaaggaggcgctgcgcgcagccggcgtgacc
gtctccgactcgccggcgcacctcggcaagcacatggctgagctcttcgccacaaaggca
taa

DBGET integrated database retrieval system