KEGG   Leishmania braziliensis: LBRM_27_2550Help
Entry
LBRM_27_2550      CDS       T01113                                 

Definition
(RefSeq) sucrose hydrolase-like protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00052  Galactose metabolism
lbz00500  Starch and sucrose metabolism
lbz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LBRM_27_2550
   00500 Starch and sucrose metabolism
    LBRM_27_2550
Enzymes [BR:lbz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LBRM_27_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-GeneID: 5416875
NCBI-ProteinID: XP_001566008
UniProt: A4HG14
Position
27:1017677..1019146
Genome map
AA seq 489 aa AA seqDB search
MSHENRIAEANNAVLAIRKTVDKEFYPHYHISPYACSMNAPCGIVYFNGLYHVFYQHNPF
GVEWGPLHWGHSTSDDMIHWRHHPIALAPGDEWDRDGCFSGSAVVYDDRLYVFYTGHHWL
TDVADDSQIYQVQCLAISENGFYFEKRGIVVKPPAGFFHFRDPYVWFQDGRWWMVCGGRD
SKDQGQLLLYSTDDLEDWDDSTFMILSKSDDRNVYMCEHPGFFSLQHRQLLMFSPQGMQS
DDYMFRNRYQTGLLMGVWRPNEIFSITSSFKKLDLGHDFYGAQSFLTHDGRRVFIGWLDM
WDTNMPTKQHNWAGMLSLPRVLLVDEVSGRIRTLPIKELENIRSTYQHVSQQTVCDNTQV
RLLNDCTSYEVRVLFDLEKSTAEKYGLWLGRGLEIYVDEQSKRLVVNRHYPNYDISGYRS
YALPVHPLLLVHAYFDMSSVEVFVNEGEAVLSTRIYPARKDRALSLFAVNGTAHIMQGDI
WALNQAVMQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcacgagaatcgcattgcggaagcgaacaacgctgtgctggcgatccgaaaaaca
gttgacaaggagttttacccgcattatcacatttccccgtatgcatgctcgatgaatgcg
ccatgtggtatagtctacttcaatggtctctatcatgttttttaccagcataacccattt
ggcgtggagtggggaccattgcactggggtcactcgacgagcgatgatatgattcactgg
cggcaccatcccatcgcacttgctcctggtgatgagtgggatcgcgatggatgcttttct
ggcagcgcggtcgtatacgatgatcgactttatgtattttacactggccaccactggctt
accgatgttgccgatgatagtcagatatatcaggtgcaatgcctggctatcagcgagaac
gggttttattttgagaagcggggtattgtagtaaagccgccggccggctttttccatttc
cgagacccgtacgtgtggttccaggatgggcgatggtggatggtgtgtggcggtcgcgac
tccaaggatcagggccagcttctcttatacagcactgatgacctggaggattgggacgac
agtacatttatgattctgtccaagtcagatgatcgtaacgtatacatgtgcgaacacccc
ggctttttctcactgcagcaccgccagctgcttatgttctcgccacaagggatgcagtct
gatgactacatgttccggaatcggtaccaaacagggctgttgatgggcgtatggaggccg
aatgagatctttagcatcacttccagcttcaaaaagctggacctgggacacgacttttat
ggagcacagtccttcctaacgcatgacggtcgacgtgtctttattggctggctcgacatg
tgggacacgaacatgcccacaaaacagcacaactgggcgggcatgctctctctgcctcgc
gttcttcttgttgacgaagttagtggcagaattcgtacgctgcctatcaaggagctggaa
aacatccgtagtacctatcagcatgtatcgcagcagactgtgtgtgacaatacgcaggtg
cggttgctcaatgactgcacgtcgtatgaggtgcgcgtgctgttcgacctggaaaagagc
acggcagaaaagtacggcctgtggctcggtagagggctggagatttacgtcgatgagcaa
agcaagcgtctcgtggtcaaccgccactaccccaactacgacattagcggataccgcagc
tatgcgcttccggtacatccgttacttctagtgcacgcgtactttgacatgtctagcgta
gaggtcttcgtgaacgaaggtgaggctgtgctgagtacccgcatttatccggcgcgcaag
gatcgggcgctttctctctttgcagtcaacggcaccgcccacattatgcaaggcgacatt
tgggcgttgaaccaggcagttatgcagtag

DBGET integrated database retrieval system