KEGG   Leishmania braziliensis: LBRM_29_2280Help
Entry
LBRM_29_2280      CDS       T01113                                 

Definition
(RefSeq) enoyl-CoA hydratase/isomerase-like protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00062  Fatty acid elongation
lbz00071  Fatty acid degradation
lbz00280  Valine, leucine and isoleucine degradation
lbz00310  Lysine degradation
lbz00380  Tryptophan metabolism
lbz00410  beta-Alanine metabolism
lbz00640  Propanoate metabolism
lbz00650  Butanoate metabolism
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
lbz01212  Fatty acid metabolism
Module
lbz_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    LBRM_29_2280
   00650 Butanoate metabolism
    LBRM_29_2280
  Lipid metabolism
   00062 Fatty acid elongation
    LBRM_29_2280
   00071 Fatty acid degradation
    LBRM_29_2280
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LBRM_29_2280
   00310 Lysine degradation
    LBRM_29_2280
   00380 Tryptophan metabolism
    LBRM_29_2280
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LBRM_29_2280
Enzymes [BR:lbz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     LBRM_29_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 5417460
NCBI-ProteinID: XP_001566571
UniProt: A4HHN0
Position
29:complement(949636..950439)
Genome map
AA seq 267 aa AA seqDB search
MYRYSRLIRCAAQPVVKTLQVGHVVTLTINRPSQLNALNRAVSESLMENLEKYDKDTSCS
VFIITGEGRAFVAGADIKSMKDRTFSEGVQSNDFSALTRMNTISKPIIAAVNGFALGGGC
ELAMSCDIIIASEGAKFGQPEIKLATIPGLGGTQRLTRMIGKARAMEWVLLGNTYTAAEA
ERAGLVSCVVKHEELMPTAMKMANTIASYSQVAVKLAKMAVNQSQETSLAAGLAYESMIF
NSTFATHDRKEGMTAFVEKRAPQFRNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgctactctcgcttgattcgctgcgccgcgcagcctgtggtgaagacgcttcaa
gttggtcacgtggtcacgttaacgatcaatcgtccttcccaactcaatgccctcaacagg
gccgtgtcggagagcctcatggaaaacttggaaaagtacgacaaggacacctcgtgttcc
gtcttcatcatcacaggcgagggtcgcgcgttcgtcgcaggggccgacatcaaatctatg
aaggatcgcaccttttccgagggcgtccagtcaaacgacttctcagcattgacccgcatg
aacaccattagcaagcctatcattgcggcagtcaatgggttcgctctgggtggagggtgt
gagcttgccatgtcgtgtgacatcattatcgccagcgagggggcgaagttcggacagccc
gagattaaattggctaccattcccggactgggcggcacgcaacgtctgacacgcatgatt
ggtaaggctcgtgcgatggagtgggtactcttgggcaacacgtacacggcggccgaggca
gagcgagcggggctcgtgtcgtgcgtggttaaacacgaggagctgatgccaaccgctatg
aagatggcgaatacgatcgcaagctacagccaggttgctgtgaagctggccaaaatggct
gtgaaccagtcgcaggagacatcactcgcggctggcttggcatacgagtctatgattttc
aattctaccttcgctacccacgacaggaaggagggcatgactgcgtttgtggaaaagcgc
gcacctcagttccgaaacaagtaa

DBGET integrated database retrieval system