KEGG   Leishmania braziliensis: LBRM_32_2550
Entry
LBRM_32_2550      CDS       T01113                                 

Definition
(RefSeq) putative C-14 sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00100  Steroid biosynthesis
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LBRM_32_2550
Enzymes [BR:lbz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LBRM_32_2550
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 5418536
NCBI-ProteinID: XP_001567608
UniProt: A4HKM3 A0A3P3ZF49
Position
32:complement(928752..930065)
AA seq 437 aa
MAKGSGAASKSVGNPLQPRTTTYEWGGPVGGFFMVLFLPTLVMALNSLCAGEQCGITQAM
RLPALMTELVHGAWPMVPKAIGIELVWLAAHAVFSILPIGRLVHGGELRNGERLAYRMNA
IHAFVISHVVLLGLHYTSIVNMAVVADLFHPLMIGAIFISFAMSVVLYAASFRRRNVLTA
LGGNSGNALYDFWIGRELNPRTGPLDWKLMCELRPGLIGWSIMNWAFVCKSVELGTVTPS
IVLTALFESFYVLDGLLLEAGNLTMMDIVTDGFGFMLCFGDLAWLPFTYTLQTKYLVHHP
AHLSPLHLCLCASLSVAGYVIFRGANTEKDRFRSNPKDPCVQHLHVMKTSKGKSLIISGY
WGMCRHPNYVGDWLMALGWAAFSGTAELLPYFHPIYFGFLLMHRQLRDEKQMREKYGRED
WNAFCRIVKYRLIPYLY
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcgaaagggagcggtgccgcttccaagtcagtggggaatcctctgcagccccgcacg
accacctacgagtggggcggcccggttggtggcttcttcatggttctcttcctccccaca
ttggttatggcgctgaacagcctctgcgctggggagcagtgcggcatcacgcaggcaatg
cggctgcctgcactgatgacggagttggtgcatggtgcgtggccgatggtaccgaaggcg
atcggcattgagcttgtgtggctcgctgcccacgctgtattttctatcctccctattggc
aggctcgtccacggtggcgagctccgcaacggcgagcgacttgcctaccgcatgaacgcc
atccacgccttcgtcatctctcacgtggtgcttcttggcttacactacacctctatcgtg
aacatggccgttgtggccgacctcttccaccccctcatgatcggtgccattttcatctcc
tttgctatgtcggtcgtgctgtacgcggcatcgttccgccgtcgcaacgtactcacagct
cttggtggcaacagcgggaacgccctgtacgacttttggatcggccgcgagctgaacccg
cgcaccggtccgctggactggaagctgatgtgtgagctgcgtcctggtctcattggctgg
agcattatgaactgggcatttgtctgcaagtcggtcgagctgggcaccgtgacgccaagc
atcgtgcttaccgcactcttcgaatccttctacgtgctggacggcctgctgctggaggcg
ggaaatctcaccatgatggacattgtgacggatggctttgggttcatgctgtgctttggt
gaccttgcgtggttaccgttcacgtacacgctgcagacaaagtacctcgttcaccacccc
gcgcacctctcgcccttgcatctgtgcctctgcgcctccctttctgttgccggctacgta
atctttcgtggcgccaacacggaaaaggaccgcttccgcagcaacccgaaagacccgtgt
gttcagcacctgcacgtcatgaagacctccaagggtaagtctctcatcatctccgggtac
tggggcatgtgccggcacccaaactacgtcggtgactggctgatggcgctcggctgggcg
gcgttcagcggcaccgcggagctgctgccatacttccatcccatttactttggtttcctt
ctcatgcaccgccagctgcgtgatgaaaaacagatgcgggagaagtacggtagggaagac
tggaacgcgttctgccgcatcgtcaagtaccggcttatcccgtacctctactag

DBGET integrated database retrieval system