KEGG   Leishmania braziliensis: LBRM_35_0310Help
Entry
LBRM_35_0310      CDS       T01113                                 

Definition
(RefSeq) putative peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
lbz  Leishmania braziliensis
Brite
KEGG Orthology (KO) [BR:lbz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LBRM_35_0310
Enzymes [BR:lbz01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     LBRM_35_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 5419626
NCBI-ProteinID: XP_001568657
UniProt: A4HNN1 A0A3P3ZID6
Position
36:complement(96144..96494)
Genome map
AA seq 116 aa AA seqDB search
MGVIRTVKKAGSGATPKAGQTITVHCTGYLAEGKKKFWSTHDDNKPFSFNVGVGQVVRGW
DEGMSQMQLGETAELLMTADYAYGARGFPAWGIPPNATLLFEIEMLKIEEGISRGV
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcattcgcacagtcaagaaggcgggcagtggcgccaccccaaaggccggccag
actatcacggtgcactgcaccggctatttggcggaagggaaaaagaagttctggtccact
cacgatgacaacaaaccgttttccttcaacgtgggcgtcgggcaggtggtccgcggctgg
gatgagggcatgtctcagatgcaacttggcgagacggcagagttgctcatgacggctgac
tatgcctacggtgctcgtggatttcctgcctgggggatcccgccgaacgccacgctgctg
tttgagattgagatgctgaagatcgaagagggcatctctcgcggtgtatga

DBGET integrated database retrieval system