KEGG   Leishmania braziliensis: LBRM_35_2550Help
Entry
LBRM_35_2550      CDS       T01113                                 

Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
lbz  Leishmania braziliensis
Pathway
lbz00010  Glycolysis / Gluconeogenesis
lbz00052  Galactose metabolism
lbz00500  Starch and sucrose metabolism
lbz00520  Amino sugar and nucleotide sugar metabolism
lbz00524  Neomycin, kanamycin and gentamicin biosynthesis
lbz01100  Metabolic pathways
lbz01110  Biosynthesis of secondary metabolites
lbz01130  Biosynthesis of antibiotics
lbz01200  Carbon metabolism
Module
lbz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lbz_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lbz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBRM_35_2550
   00052 Galactose metabolism
    LBRM_35_2550
   00500 Starch and sucrose metabolism
    LBRM_35_2550
   00520 Amino sugar and nucleotide sugar metabolism
    LBRM_35_2550
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    LBRM_35_2550
Enzymes [BR:lbz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     LBRM_35_2550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-GeneID: 5419850
NCBI-ProteinID: XP_001568875
UniProt: A4HPA0
Position
36:947788..949023
Genome map
AA seq 411 aa AA seqDB search
MVQTKEIALEQLALTLTGDASWSSGPIYVVCDVGGTSARVGFSQASQHDRSGLHIIYVRF
KVTKSDIRQLLEFFDEVLQHLKKNLPDHGASFLRRVASGAVSVPGPVTNGQLAGPFNNLK
GIARLVDYPVELFPKGRSALLNDLEAGAYGVLALSNAGILSDYFKVMWKGTQWDALSEGK
PAGSTIGRGRCMVVAPGTGVGSSLIHYVGVSDSYIVLALECGSLSMSWCANEDSKYVQAL
AGYMASKAHAKGLDSTVAPIWEAASNGAGLEFNYAYAKEGQKASAPLKSAPEVAKLAKSG
SDTAAIAAVDRLYKNLIGLTAETTMQFLPLTCVLMGDNVVANSFYFEKPENVKRLQARLH
EHAMERQFKFLSRTTFLRQVSSVNINLLGCLGFGSQLSKSADQVVPTKSHL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaccaaagaaatcgcgctcgagcagctggccctgactctcacgggcgatgcc
tcctggtcctccggccccatctacgttgtgtgtgatgttggtggcacgagcgcgcgcgtc
ggtttttctcaagcgtcgcagcacgacagaagtggtctgcacatcatttacgtccgcttc
aaggtgacaaagagcgacattcgccagctgctcgagttcttcgatgaggtgctgcaacac
ctgaagaagaacttgcccgaccacggcgcctcctttctgcgtcgggtggcgtcgggtgct
gtgagtgtgccgggaccggtcaccaacggacaactcgccggccccttcaacaatctgaag
ggcattgcgcggctggtggactacccagtggagctgtttccgaagggccgcagcgcgctc
ctaaacgatctagaggcgggcgcctatggtgtgctagctctgagcaacgccggtatattg
tctgactatttcaaggtcatgtggaagggcacgcagtgggacgcgctgtcggaaggcaag
cccgccggcagtaccatcggtcgcggccgctgcatggttgtggcccccggcaccggtgtt
ggctcctctctcatccactacgtgggtgtctcggacagctatatcgtgctggcgctggag
tgcggctctctgtccatgtcatggtgtgccaacgaggactcgaagtatgtccaggcactt
gctgggtacatggcatccaaggcgcatgcaaagggcctggactcgacggtggccccaatc
tgggaggctgcgtcaaatggcgccggattggagttcaactacgcgtacgccaaggaaggg
cagaaggcatctgcacctctcaagtccgcgcccgaagtggccaagctcgccaagagtggc
agcgacacagcagccatcgccgccgtggaccgcctctacaagaacctcataggcctcaca
gccgagacgacgatgcagttcctaccactgacgtgtgtgctgatgggcgacaatgtcgtt
gccaacagcttctacttcgagaaaccagagaatgtgaagaggttgcaggctcgcctgcac
gagcacgcgatggagcgtcagtttaaattcttgagtcgcaccacatttcttcgtcaggtg
agcagtgtgaacatcaacctgctggggtgccttggatttggtagccagctctccaagtcg
gcagatcaagtggtgccgaccaagtcacacttgtga

DBGET integrated database retrieval system