KEGG   Lacticaseibacillus paracasei ATCC 334: LSEI_1410
Entry
LSEI_1410         CDS       T00407                                 

Name
(GenBank) Pyruvate-formate lyase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
lca  Lacticaseibacillus paracasei ATCC 334
Pathway
lca00620  Pyruvate metabolism
lca00640  Propanoate metabolism
lca00650  Butanoate metabolism
lca01100  Metabolic pathways
lca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LSEI_1410
   00640 Propanoate metabolism
    LSEI_1410
   00650 Butanoate metabolism
    LSEI_1410
Enzymes [BR:lca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     LSEI_1410
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: ABJ70188
UniProt: Q039D4
Position
1401033..1403294
AA seq 753 aa
MKQLDETKVPNYWEGFNGGDWQEEINVRDFIEHNLNQYDGDESFLAGPTEATTVLNNQVL
NLKKQERANGGVLDADNNIPSTITSHGPGYLNKDLEKIVGVQTDKPFKRAFMPFGGIRMA
EDALESYGFKTDPQEHKIFNEYRKTHNQGVFDAYTPDMRKARHYKIVTGLPDAYGRGRIV
SDFPRIAVYGIDRLMAEKFKDYNLTGDGEMTDDVIKLREEINEQYRALNDMKKMAKEYGY
DISRPAANAQEAVQWIYFGYLAAVKTQNGAAMSVGRIDTVIDAYIQRDMRLGKLNEEQAQ
ELIDHLVMKLRMVRFIRTEEYNSLFSGDPIWATLSLAGMGNDGRHHVTKTAFRFLKTLDN
MGAAPEPNITLLWSERLPEGFKRYATEVSIQSSTIQYENDDLMRNEWGTDYYGIACCVSA
QPIADGVQYFGARANLAKTVLYAINGGKDEIQEAQVGPEYAPITSDYIDYKEFMNKFDKM
MDWLADTYVNALNVIHYMHDKYYYEAAQLALKDTQLNRTFATGISGLSHAVDSISAIKYG
HVKAIRDENGVAVDFVADNDDYPRYGNNDDRADDIAKWLVKTFYNKMNTHHLYRGAKLST
SVLTITSNVVYGKNTGTTPNGRQKGEPFSPGANPAYGAEKNGALASLMSTAKIPYHYATD
GISNTFGVTPNTLGHDDETRKDTLVHMVDGYMENSGMHLNINVFNKETLIDAQKHPEEYP
TLTVRVSGYCVYFADLTKEQQDDVIARTFFEEM
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgaaacagcttgacgaaaccaaagttcctaattattgggaaggctttaacggcggcgac
tggcaagaagaaattaatgtgcgcgattttatcgagcataacctgaaccaatatgacggg
gacgaaagtttccttgctggtcccactgaagcgacaacagtcctgaacaatcaggttcta
aatttaaagaagcaagaacgtgcaaatggcggtgttttggatgctgacaacaatattcca
tctacgatcacctcacacggccctggttatttgaacaaagatcttgaaaagattgttggt
gttcagaccgacaagccattcaaacgagcattcatgccatttggcggtattcgaatggct
gaagatgcattggaatcttatggcttcaagacagatcctcaagaacacaagattttcaat
gaatatcgtaagacccataaccaaggtgtctttgatgcttatacccctgatatgcgaaag
gctcgccattacaagatcgtgactggcttgccagacgcatacggccgcggccggattgtt
tctgatttcccacggatcgctgtttacgggatcgatcgtttaatggctgagaagttcaag
gattataacttgaccggcgacggcgaaatgactgacgatgtaatcaaattgcgtgaagaa
atcaatgaacaatatcgtgccttaaacgacatgaagaagatggccaaggaatatggctat
gacatctcgcgtccggcagctaatgcgcaagaagctgttcagtggatctactttggctat
ctggctgctgttaagactcaaaacggtgccgcaatgtccgttggccggatcgatacggtt
attgatgcttatatccaacgcgatatgcgcttaggcaaattgaacgaagaacaggcacag
gaactgattgatcatttggttatgaaattgcggatggttcgtttcatccggactgaagaa
tataactcactgttctcaggcgatccaatctgggcaaccttgtcattggcaggaatgggc
aatgatggccgtcaccacgttaccaagacggctttccgtttcctgaagactttggacaac
atgggcgcagcaccagaaccaaacatcaccttgctttggagcgaacgcttgccagaaggc
tttaaacgctatgcaaccgaagtatccatccaaagttcaaccattcaatatgaaaatgat
gacctgatgcgcaatgaatggggtaccgattactacggtattgcttgctgtgtctcggca
caaccaattgctgatggcgttcaatactttggtgcccgtgctaacttagctaagacggtt
ctgtatgcgatcaacggtggtaaagatgaaattcaggaagcgcaagtagggcctgaatat
gcaccgatcaccagcgattacattgattacaaagaattcatgaataagttcgacaagatg
atggactggctggccgacacgtatgtcaatgctttgaatgtgattcactatatgcatgac
aagtattattatgaagctgcacagctggcattgaaggatacccaactgaaccggaccttc
gcaaccgggatttccggcctgtcacacgcggttgattccatcagtgcaatcaagtatggt
catgtcaaggcaattcgcgatgaaaatggtgttgcagttgacttcgttgctgacaatgat
gactatccacgttatggtaacaacgatgatcgcgctgatgacatcgctaagtggttggtt
aagaccttctataacaagatgaacacgcatcatctgtatcgcggcgcgaagttgagtacc
agtgtcctgaccattacttccaacgtggtttatggtaagaatacagggacaacaccaaac
ggtcgtcaaaaaggcgaaccattctcaccaggtgccaacccggcatacggcgcagaaaag
aacggcgcattggcatccttgatgtccaccgccaagattccgtatcattacgcaactgac
ggcattagtaatacgtttggggttactccgaacacactgggccacgatgatgaaactcgt
aaggataccttggttcacatggttgacggctatatggaaaacagcggcatgcatttgaac
atcaacgtcttcaacaaggagaccctgattgatgctcagaagcacccagaagaataccca
acattgaccgttcgggtttctggctactgcgtctacttcgcagatttgaccaaggaacaa
caagacgatgtcattgctcggaccttcttcgaagaaatgtaa

DBGET integrated database retrieval system