KEGG   Lactobacillus paracasei ATCC 334: LSEI_0821Help
Entry
LSEI_0821         CDS       T00407                                 

Definition
(RefSeq) HAD family sugar phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00627  Aminobenzoate degradation
lca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lca00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    LSEI_0821
Enzymes [BR:lca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     LSEI_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 4419583
NCBI-ProteinID: YP_806099
UniProt: Q03AW5
Position
818281..819057
Genome map
AA seq 258 aa AA seqDB search
MKYKGYMIDLDGTIYRGKERIPAAKDFVERLQAAQIPFLFLTNNTTKSPEDVVKNLAENH
DIHVQPAQVYTPALATAAYLTDLNHGDVTGKSIYIIGELGLKQAVLDTGLRLNEVDPDYV
VVGLDYDVTYHKFELATLAIKRGAKFIGTNADTNLPNERGLVPGAGSLIALVERSTQQRA
FYIGKPEPTIMEKALKKMGLPKEAVAMVGDNYNTDIKAGLNAGIDTILVYTGVSTRDYVS
KQVHQPTHQIDALTDWEV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
ttgaagtataaaggctatatgatcgatcttgatggcactatctatcgcggtaaggagcgg
attcccgctgcaaaggatttcgttgaacgactacaggcggcacaaatcccgtttttattt
ttaactaacaacacgaccaaaagtccagaagatgtggtcaaaaacttagcagagaatcat
gatattcatgtccaaccggcgcaggtatacaccccggcactagcaactgcagcgtatctg
accgaccttaatcatggcgatgtgacgggtaagtccatttatatcattggcgagttaggc
ctcaagcaggcggtgctggatactggattacgattaaatgaagttgatccggattatgtg
gtcgtcggccttgactatgatgtgacttatcataagtttgaactggcaacactggcgatt
aaacgcggggcaaagtttattgggacgaatgctgacaccaatctcccgaatgagcgcggt
ttggttccaggcgcgggctcattgatcgcgttagtggagcgcagcacacagcagcgggct
ttttacattggcaaacccgaaccaacgattatggagaaagccttgaaaaaaatgggctta
cctaaagaagcggttgccatggttggcgataattacaacacggacattaaggcagggctg
aatgctggtattgatacgattttagtgtataccggcgtttctactcgtgattatgtttcc
aagcaagtccatcagcccacacatcagattgatgccttgacggattgggaggtctaa

DBGET integrated database retrieval system