KEGG   Lactobacillus paracasei ATCC 334: LSEI_1057Help
Entry
LSEI_1057         CDS       T00407                                 

Definition
(RefSeq) Asp-tRNA-Asn/Glu-tRNA-Gln amidotransferase C subunit
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00970  Aminoacyl-tRNA biosynthesis
lca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LSEI_1057
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lca03029]
    LSEI_1057
Enzymes [BR:lca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     LSEI_1057
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     LSEI_1057
Mitochondrial biogenesis [BR:lca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    LSEI_1057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 4418842
NCBI-ProteinID: YP_806293
UniProt: Q03AC1
Position
1040550..1040846
Genome map
AA seq 98 aa AA seqDB search
MISKDSVAHVAGLAKLQFSETELEKYTSQLSEILDMVEQLESVPTQDVPVTTQSIHLENV
MRADVAKPGEPVADLLKNVPTKKGTLIQVPAIIDKEED
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgatttctaaagacagtgttgcgcatgtggcaggattggccaagttgcaattttctgaa
acggaactggagaaatacaccagccagctctccgagattctcgatatggttgaacaacta
gaaagtgttccgacacaagatgtgccggtaactactcagagtattcatctggaaaatgtg
atgcgagcggatgtcgctaagccaggcgaaccggtagcggacttgttgaaaaatgtgcca
accaagaagggcacgttgatccaagttccagcgatcatcgataaagaggaggactag

DBGET integrated database retrieval system