KEGG   Lactobacillus paracasei ATCC 334: LSEI_1757Help
Entry
LSEI_1757         CDS       T00407                                 

Definition
(RefSeq) hypothetical protein
  KO
K16789  thiamine transporter
Organism
lca  Lactobacillus paracasei ATCC 334
Brite
KEGG Orthology (KO) [BR:lca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lca02000]
    LSEI_1757
Transporters [BR:lca02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   LSEI_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thia_YuaJ
Motif
Other DBs
NCBI-GeneID: 4420237
NCBI-ProteinID: YP_806971
UniProt: Q037U3
Position
complement(1751727..1752332)
Genome map
AA seq 201 aa AA seqDB search
MQQHKQLVVILETAIIAAFAMALTYIPHTTGVSAIELNYGLIPIAVLAMRRGLVPAAWAG
FVWGILDLILRGIGGGSVLNPLQGILEYPIAFTLVGLMGLTFASFQKAVRGSEKVKASGY
AFAGIIIGTFAKYFIHFIAGVVFWGAYAPKGTNVWVYSLIVNGGSALFSTVLTIVVVGVL
LTVAPQLFVAKDGKSFSTKAA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagcacaagcaacttgttgtcattttggaaactgcgatcattgcagcttttgcg
atggcattaacttatattccacataccacgggtgtttcggcaattgaactgaattatggt
ctgattccaattgctgttttggctatgcggcgtgggttagttcctgcagcatgggcaggc
tttgtctgggggattttggatctgattttgcgtggtattggcggtggcagtgtcttgaat
cctttacaaggtattcttgaatatccgattgcgtttaccttggtcggtttaatggggttg
acgtttgcatctttccaaaaggcagtgcgcggtagtgaaaaagtgaaggcgagcggctat
gcctttgctggtattattatcggcacgtttgctaaatactttatccatttcatcgctggc
gttgttttctggggtgcgtatgcgcctaaaggaacgaatgtctgggtatactcgttgatc
gtcaatggtggatcagcgttattcagcaccgtcttaacaattgttgttgttggtgtattg
ctaaccgttgccccgcaactctttgttgctaaggacggcaaatcattttcaacgaaggct
gcctaa

DBGET integrated database retrieval system