KEGG   Lactobacillus paracasei ATCC 334: LSEI_1787Help
Entry
LSEI_1787         CDS       T00407                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00071  Fatty acid degradation
lca00072  Synthesis and degradation of ketone bodies
lca00280  Valine, leucine and isoleucine degradation
lca00310  Lysine degradation
lca00362  Benzoate degradation
lca00380  Tryptophan metabolism
lca00620  Pyruvate metabolism
lca00630  Glyoxylate and dicarboxylate metabolism
lca00640  Propanoate metabolism
lca00650  Butanoate metabolism
lca00900  Terpenoid backbone biosynthesis
lca01100  Metabolic pathways
lca01110  Biosynthesis of secondary metabolites
lca01120  Microbial metabolism in diverse environments
lca01130  Biosynthesis of antibiotics
lca01200  Carbon metabolism
lca01212  Fatty acid metabolism
lca02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LSEI_1787
   00630 Glyoxylate and dicarboxylate metabolism
    LSEI_1787
   00640 Propanoate metabolism
    LSEI_1787
   00650 Butanoate metabolism
    LSEI_1787
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LSEI_1787
   00072 Synthesis and degradation of ketone bodies
    LSEI_1787
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LSEI_1787
   00310 Lysine degradation
    LSEI_1787
   00380 Tryptophan metabolism
    LSEI_1787
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LSEI_1787
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LSEI_1787
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LSEI_1787
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lca04147]
    LSEI_1787
Enzymes [BR:lca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LSEI_1787
Exosome [BR:lca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSEI_1787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 4419714
NCBI-ProteinID: YP_807000
UniProt: Q037R4
Position
complement(1780622..1781803)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcgattaaggct
gcacgaattgacccagcgttactcaaccaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgtggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggcgatacaacgctggtt
gacggtttgagtcgcgatggattaaatgatgccttcagtcaacagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgtcagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system