KEGG   Lactobacillus paracasei ATCC 334: LSEI_2045Help
Entry
LSEI_2045         CDS       T00407                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca00010  Glycolysis / Gluconeogenesis
lca00030  Pentose phosphate pathway
lca00051  Fructose and mannose metabolism
lca00680  Methane metabolism
lca01100  Metabolic pathways
lca01110  Biosynthesis of secondary metabolites
lca01120  Microbial metabolism in diverse environments
lca01130  Biosynthesis of antibiotics
lca01200  Carbon metabolism
Module
lca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSEI_2045
   00030 Pentose phosphate pathway
    LSEI_2045
   00051 Fructose and mannose metabolism
    LSEI_2045
  Energy metabolism
   00680 Methane metabolism
    LSEI_2045
Enzymes [BR:lca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LSEI_2045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos_2
Motif
Other DBs
NCBI-GeneID: 4420592
NCBI-ProteinID: YP_807242
UniProt: Q036S2
Position
complement(2027774..2029705)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGGAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAITNLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREED
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacggtgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttacctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcaggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcacccgagtttgtctatatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttactattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacgtgtcaa
acgattcaacgtttaacggtagatcactttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcggcgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccggttagcggaacaatactatcaagataatccc
gccttttcaccaaaaatggagcgatcagatcgaccaattactgaggcggagcgacttcaa
attacccagattcatcaggcgattgcgatgattcaatttaagctggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtactggagaaactggcgcctgat
ttctcaaccatcaaattgaatggtgatacttatacgattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactccgaaaagttgcatcgccacatggattttctacttgatcac
ggcagcatgtatttgcggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggatggcaattttattggcttgaccattaaaggaacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgcggac
ttagcaaccgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgttgaaggt
cgtaatccgtattatcacctgcgtaaggacccggaatttatcaaaaagatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatggccatacgccagtcaaaaagggc
accgaccccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggttacacgcttttggataattcttatggtatgcaa
ctagtgacgcaccaaccattcaccacaaaagctgatgctatcaccaacctcaccgatatt
atttcaacccgccgtgtcgtcgaaaccgaagcccgccgccgaacagtggcggaaactgac
attggcactgagctacaggatgaggttgaggtattgaagcggcgcttgggtgaattgcgg
gaagaggactag

DBGET integrated database retrieval system