KEGG   Lactobacillus paracasei ATCC 334: LSEI_2498Help
Entry
LSEI_2498         CDS       T00407                                 

Gene name
rplV
Definition
(RefSeq) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
lca  Lactobacillus paracasei ATCC 334
Pathway
lca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:lca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LSEI_2498 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:lca03011]
    LSEI_2498 (rplV)
Ribosome [BR:lca03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LSEI_2498 (rplV)
  Bacteria
    LSEI_2498 (rplV)
  Archaea
    LSEI_2498 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 4421078
NCBI-ProteinID: YP_807676
UniProt: Q034Y8
Position
complement(2468461..2468814)
Genome map
AA seq 117 aa AA seqDB search
MADQITSATATAKTVRIAARKARLVIDLIRGRDVAEALAILEFTPRSGSPIIEKVLKSAI
ANAEHNYDLDAQNLYVSKAYVNEGPTLKRFRPRAKGSASPINKRTSHVTVVVSEKEA
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaaattacgtctgcaacggcaacggccaagacagttcggattgctgctcgc
aaagcgcgcctggtaatcgacttgattcgcggtcgcgatgttgctgaagcattggcaatc
ttagaattcacccctcgatccggttcaccgatcatcgagaaggtactcaagtctgccatc
gctaatgcagaacataactatgacttagatgcacaaaacctttatgtaagcaaggcttac
gtcaacgaaggcccgaccctcaagcggttccgtcctcgtgccaaggggagcgcatcacca
atcaacaaacggacaagccacgttaccgtggttgtatccgaaaaagaagcataa

DBGET integrated database retrieval system