KEGG   Lacticaseibacillus paracasei BL23: LCABL_16340
Entry
LCABL_16340       CDS       T00723                                 

Symbol
pflB
Name
(GenBank) Formate C-acetyltransferase (Pyruvate formate-lyase) (Formate acetyltransferase)
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
lcb  Lacticaseibacillus paracasei BL23
Pathway
lcb00620  Pyruvate metabolism
lcb00640  Propanoate metabolism
lcb00650  Butanoate metabolism
lcb01100  Metabolic pathways
lcb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCABL_16340 (pflB)
   00640 Propanoate metabolism
    LCABL_16340 (pflB)
   00650 Butanoate metabolism
    LCABL_16340 (pflB)
Enzymes [BR:lcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     LCABL_16340 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: CAQ66715
Position
1570834..1573095
AA seq 753 aa
MKQLDETKVPNYWEGFNGGDWQEEINVRDFIEHNLNQYDGDESFLAGPTEATTVLNNQVL
NLKKQERANGGVLDADNNIPSTITSHGPGYLNKDLEKIVGVQTDKPFKRAFMPFGGIRMA
EDALESYGFKTDPQEHKIFNEYRKTHNQGVFDAYTPDMRKARHYKIVTGLPDAYGRGRIV
SDFPRIAVYGIDRLMAEKFKDYNLTGDGEMTDDVIKLREEINEQYRALNDMKKMAKEYGY
DISRPAANAQEAVQWIYFGYLAAVKTQNGAAMSVGRIDTVIDAYIQRDMRLGKLNEEQAQ
ELIDHLVMKLRMVRFIRTEEYNSLFSGDPIWATLSLAGMGNDGRHHVTKTAFRFLKTLDN
MGAAPEPNITLLWSERLPEGFKRYATEVSIQSSTIQYENDDLMRNEWGTDYYGIACCVSA
QPIADGVQYFGARANLAKTVLYAINGGKDEIQEAQVGPEYAPITSDYIDYKEFMNKFDKM
MDWLADTYVNALNVIHYMHDKYYYEAAQLALKDTQLNRTFATGISGLSHAVDSISAIKYG
HVKAIRDENGVAVDFVADNDDYPRYGNNDDRADDIAKWLVKTFYNKMNTHHLYRGAKLST
SVLTITSNVVYGKNTGTTPNGRQKGEPFSPGANPAYGAEKNGALASLMSTAKIPYHYATD
GISNTFGVTPNTLGHDDETRKDTLVHMVDGYMENSGMHLNINVFNKETLIDAQKHPEEYP
TLTVRVSGYCVYFADLTKEQQDDVIARTFFEEM
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgaaacagcttgacgaaaccaaagttcctaattattgggaaggctttaacggcggcgac
tggcaagaagaaattaatgtgcgcgattttatcgagcataacctgaaccaatatgacggg
gacgaaagtttccttgctggccccactgaagcgacaacagtcctgaacaatcaggttcta
aatttaaagaagcaagaacgtgcaaatggcggtgttttggatgctgacaacaatattcca
tctacgatcacctcacacggccctggttatttgaacaaagatcttgaaaagattgttggt
gttcagaccgacaagccattcaaacgagcattcatgccatttggcggtattcgaatggct
gaagatgcattggaatcttatggcttcaagacagatcctcaagaacacaagattttcaat
gaatatcgtaagacccataaccaaggtgtctttgatgcttatacccctgatatgcgaaag
gctcgccattacaagatcgtgactggcttgccagacgcatacggccgtggccggattgtt
tctgatttcccacggatcgctgtttacgggatcgatcgtttaatggctgagaagttcaag
gattataacttgaccggcgacggcgaaatgactgacgatgtaatcaaactgcgtgaagaa
atcaatgaacaatatcgtgccttaaacgacatgaagaagatggccaaggaatatggctat
gacatctcgcgtccggcagctaatgcgcaagaagctgttcagtggatctactttggctat
ctggctgctgttaagactcaaaacggtgccgcaatgtccgttggccggatcgatacggtt
attgatgcttatatccaacgcgatatgcgcttaggcaaattgaacgaagaacaggcacag
gaactgattgatcatttggttatgaaattgcggatggttcgtttcatccggactgaagaa
tataactcactgttctcaggcgatccaatctgggcaaccttgtcattggcaggaatgggc
aatgatggccgtcaccacgttaccaagacggctttccgtttcctgaagactttggacaac
atgggcgcagcaccagaaccaaacatcaccttgctttggagcgaacgcttgccagaaggc
ttcaaacgctatgcaaccgaagtatccatccaaagttcaaccattcaatatgaaaatgat
gacctgatgcgcaacgaatggggtaccgattactacggtattgcttgctgtgtctcggca
caaccaattgctgatggcgttcaatactttggtgcccgtgctaacttagctaagacggtt
ctgtatgcgatcaacggtgggaaagatgaaattcaggaagcgcaagtagggcctgaatat
gcaccgatcaccagcgattacattgattacaaagaattcatgaataagttcgacaagatg
atggactggctggccgacacgtatgtcaatgctttgaatgtgattcactatatgcatgac
aagtattattatgaagctgcacagctggcattgaaggatacccaactgaaccggaccttc
gcaaccgggatttccggcctgtcacacgcggttgattccatcagtgcaatcaagtatggt
catgtcaaggcaattcgcgatgaaaacggtgttgcagttgacttcgttgctgacaatgat
gactatccacgctatggtaacaacgatgatcgcgctgatgacatcgctaagtggttggtt
aagaccttctataacaagatgaacacgcatcatctgtatcgcggcgcgaagttgagtacc
agtgtcctgaccattacctccaacgtggtttatggtaagaatacagggacaacaccaaac
ggtcgtcaaaaaggcgaaccattctcaccaggtgccaacccggcatacggcgcagaaaag
aacggcgcattggcatccttgatgtccaccgccaagattccgtatcattacgcaactgac
ggcattagtaatacgtttggggttactccgaacacactgggccacgatgatgaaactcgt
aaggataccttggttcacatggttgacggctatatggaaaacagcggcatgcatttgaac
atcaacgtcttcaacaaggagaccctgattgatgctcagaagcacccagaagaataccca
acattgaccgttcgggtttctggctactgcgtctacttcgcagatttgaccaaggaacaa
caagacgatgtcattgctcggaccttcttcgaagaaatgtaa

DBGET integrated database retrieval system