KEGG   Lactobacillus casei BL23: LCABL_01130Help
Entry
LCABL_01130       CDS       T00723                                 

Gene name
purA
Definition
(GenBank) Adenylosuccinate synthetase (IMP--aspartate ligase) (AdSS) (AMPSase)
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00230  Purine metabolism
lcb00250  Alanine, aspartate and glutamate metabolism
lcb01100  Metabolic pathways
Module
lcb_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LCABL_01130 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LCABL_01130 (purA)
Enzymes [BR:lcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     LCABL_01130 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: CAQ65245
UniProt: B3W7G1
Position
113134..114429
Genome map
AA seq 431 aa AA seqDB search
MGTVVIVGTQWGDEGKGKITDFLSQGAKVVSRYQGGDNAGHTIHANGEVYKLRLVPSGVL
YPHQLSVIGNGVVVNPKSLVGELARLAEQGVTGENLRISDRAHVILPYHIKLDKLQEAAK
GADKIGTTNRGIGPAYMDKAARVGIRMADLLDKEIFEERLKANLKAKNEEFVKVYDSTPM
NFDDIFEEYYQYGQQLKQYVCDTSIVLNDAIDKSEHVLFEGAQGIMLDIDQGTYPFVTSS
NPAGGVTVGAGVGASKIDRVVGVAKAYTSRVGDGPFPTELLDKTGDFIRNAGHEFGTVTG
RPRRIGWFDAVVVRHSRRVAGITDLCLNSIDVLTGLDKVKICVAYERDGERVENYPASLK
FLSECKPVYEELPGWQEDITKAKTLDDLPENARRYVERITELLGVDLLTFSVGPDRDQTN
VLENVWDKVSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgtagttattgtcggtacacaatggggcgacgaaggtaaagggaagattacg
gatttcctgagccaaggcgccaaggtggtcagccgttatcaaggcggtgacaatgcaggc
catacgatccatgcaaatggcgaggtttataagctgcgcctcgtaccatcaggggtactc
tacccgcatcagttatcggtgatcggtaatggtgttgttgtgaatcctaagagcttggtc
ggtgaattggcccggctcgcagaacaaggcgtgactggcgaaaatctgcggatttcagac
cgtgctcacgtgattttgccttatcatattaaattagataaattgcaggaagcagccaag
ggcgccgacaagattgggacgaccaatcgcggcatcggcccggcctatatggacaaggct
gctcgagttggcattcggatggctgacttgctcgacaaagaaatctttgaagaacgcctc
aaagctaatttgaaagctaagaatgaagaattcgtcaaagtttatgatagtacgccgatg
aattttgatgatatctttgaagaatattatcaatatggccaacaattgaaacagtatgtt
tgcgacacctcaattgtgttgaacgatgcgattgacaaaagtgaacacgttttgtttgaa
ggcgcgcaagggattatgctggatattgaccaagggacctatccgttcgtaacgtcatcg
aaccctgctggcggtgtgacggttggtgccggcgttggtgcctccaagattgatcgggtt
gtgggggttgcgaaagcttacacctcccgcgttggcgacggtccgttcccaactgaattg
ctcgataaaaccggagatttcattcgcaatgctggccacgaattcggtactgtaaccggc
cgacctcggcggattggctggttcgatgctgtcgttgttcgtcattctcgccgtgttgcc
gggattacggatctgtgcctcaactcaattgatgtgctaaccggtttggacaaagtcaaa
atctgtgttgcctacgaacgcgatggcgaacgggttgaaaactacccagcttcgctcaag
ttcctcagtgaatgcaagccagtgtatgaagaactgccaggttggcaagaagatattacc
aaagccaaaactttggatgatcttccggaaaatgcgcggcgttacgttgaacgcatcaca
gaattacttggtgttgacctgctgacattctcagttggccctgaccgtgaccaaaccaat
gtccttgagaatgtttgggataaggtatcgcgctag

DBGET integrated database retrieval system