KEGG   Lactobacillus casei BL23: LCABL_12560Help
Entry
LCABL_12560       CDS       T00723                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00040  Pentose and glucuronate interconversions
lcb00052  Galactose metabolism
lcb00500  Starch and sucrose metabolism
lcb00520  Amino sugar and nucleotide sugar metabolism
lcb01100  Metabolic pathways
lcb01130  Biosynthesis of antibiotics
Module
lcb_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LCABL_12560 (galU)
   00052 Galactose metabolism
    LCABL_12560 (galU)
   00500 Starch and sucrose metabolism
    LCABL_12560 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    LCABL_12560 (galU)
Enzymes [BR:lcb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LCABL_12560 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: CAQ66340
Position
1211782..1212696
Genome map
AA seq 304 aa AA seqDB search
MKVRKAVIPAAGLGTRFLPATKALAKEMLPIVDKPTIQFIVEEAKASGIEDILIVEGKQK
RSIEDHFDSAPELEQNLKEKHKDALLELVHSTTDIGVNLFFVRQPYPRGLGDAVRLAKSF
VGDEPFVVMLGDDLMHDKVPLTKQLINEYDKTHASILAVKKVPHDEVSAYGVIDPEKEVS
KGLFNVKKFVEKPAVADAPSDLAIIGRYLLTPEIFDILENQKPGKGNEIQLTDAIDTLNQ
TQRVFAHEFTGDRYDVGNKFGYVKTNIEYGLTHPEVKDELRAYILDLASKLQANKPVGKP
ANKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagttcgtaaggcagtcattccggcagccgggcttgggacccgctttctgccagca
actaaagctttagccaaagagatgttaccaatcgttgataaaccaaccattcagttcatc
gttgaagaggctaaggccagcgggattgaagacattctgatcgttgagggtaaacaaaaa
cgttctattgaggaccatttcgattctgctcctgaattggaacagaatttgaaagaaaaa
cataaagatgccttgttggagttggttcactccactactgacatcggcgttaatctcttc
ttcgttcgccagccatatccgcgcggccttggggatgccgttcgtttggcgaagtcattc
gttggcgacgaaccatttgttgtcatgctcggcgatgacctgatgcatgacaaggtaccg
ttgaccaagcaactgattaacgaatacgataagacccacgcatccattcttgctgttaaa
aaagtgccacatgacgaagtttcagcttatggcgttattgaccctgaaaaagaagtttca
aagggactcttcaacgtcaagaaatttgttgaaaagccagctgttgccgatgcaccaagt
gacttggccatcattggtcgttacttgttgacaccagagatctttgatattctcgaaaat
caaaaacctggtaagggtaacgaaattcaactcaccgatgccatcgacaccttgaaccaa
acccagcgtgtcttcgcccatgaattcaccggagatcgttatgacgttgggaataagttt
ggctatgtgaagaccaacatcgagtatggcttgacccatccagaagtgaaggatgagctg
cgtgcttatattcttgacttggcttcaaagctacaggcaaataagcctgtggggaagccg
gcaaataagaagtaa

DBGET integrated database retrieval system