KEGG   Lactobacillus casei BL23: LCABL_15010
Entry
LCABL_15010       CDS       T00723                                 

Gene name
murD
Definition
(GenBank) UDP-N-acetylmuramoylalanine--D-glutamate ligase (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme)
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00471  D-Glutamine and D-glutamate metabolism
lcb00550  Peptidoglycan biosynthesis
lcb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    LCABL_15010 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCABL_15010 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lcb01011]
    LCABL_15010 (murD)
Enzymes [BR:lcb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     LCABL_15010 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:lcb01011]
 Precursor biosynthesis
  Amino acid ligase
   LCABL_15010 (murD)
SSDB
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_3 AlaDh_PNT_C
Other DBs
NCBI-ProteinID: CAQ66582
UniProt: B3WDY1
Position
1424834..1426213
AA seq 459 aa
MKNISDYRNKKVLVLGLAKSGVNAARLLHKLGALVTVNDKQQFDDNKDAQELLADGMRVI
TGRHPVELLDEHFELMVKNPGIPYSNPMVKRAEALHMPIITEPELAYQVSEAQWIGITGT
NGKTTTTTLIGLMLNQQRPHHAFDAGNIGIPVSQVAQKVGKDDTIVAELSSFQLCGIKTL
HPHIAVLTNIYEAHLDWHGNRANYVAAKMRITMNQTPDDYFIMNWDLPEMHELAKQSKAQ
IVPFSRKNAEGARAQLIDGWLTFDGDRIMKASEMQIPGLHNIENALAAIAAVKLEGVGDD
AIREVLRTFSGVKHRIQYLETIDGRRVYNDSKATNVEAATVALNAFDQPIVWLAGGLDRG
LPMDALTPLVKKHVKSMVVFGQTAPLMAKIGKDAGVPVQTTENVMTAVPLAYEVSRPGDV
ILLSPAAASWDQYPNFEVRGDDFIKAVNQLKATVESGDK
NT seq 1380 nt   +upstreamnt  +downstreamnt
gtgaagaatatttcggattatcgcaataaaaaagtgcttgttttgggattagcgaaaagt
ggcgtgaatgcggcacgcctattacataagttgggcgctttagtgacagtcaatgacaaa
caacaatttgacgacaacaaagacgctcaggaactgcttgcagacggtatgcgggtcatt
accggcaggcatccggttgagctcttagacgagcatttcgagttgatggtcaaaaatcct
ggcattccatacagtaatccgatggttaagcgggctgaggcgttacatatgccaattatc
actgaacccgagttggcttatcaggtttcggaagctcaatggatcgggattactgggaca
aacggtaaaacgaccacaaccacgctgattggcttgatgttgaatcagcagcggccacat
catgcgtttgatgcgggcaatattggcattcccgttagtcaagtcgctcaaaaagtcggc
aaagacgatacgattgtggctgagttgtcgagttttcaactgtgtggcatcaaaacgttg
catccacatattgccgttctaacgaatatttatgaagctcatctggattggcatggcaac
cgggcaaattatgttgcggccaaaatgcgaattaccatgaatcaaacgccagacgactat
ttcatcatgaactgggatttgccagaaatgcatgagttggcgaaacagagcaaggcacaa
atcgtcccgttctcaagaaagaacgcggaaggcgctcgagctcagttaatcgatggttgg
ctgacgtttgatggcgatcggattatgaaggccagcgagatgcagatccccggcttacat
aatatcgaaaatgcgttagctgccatcgctgccgtgaaactcgaaggggtcggcgacgat
gctattcgcgaagtgctgcgaacattctccggggttaaacatcggattcaatatctagaa
accattgatggccgccgggtctacaacgattcaaaagcgactaacgttgaggcagccacc
gttgccttgaatgcattcgaccaaccgattgtctggttggcaggtggtttggatcgcgga
ttgccaatggatgcactgacaccactggttaagaaacacgttaaaagcatggttgttttt
ggtcaaacagcacccttgatggccaagattggtaaagatgccggggtaccagttcaaacg
actgagaatgtgatgactgcggtgccacttgcctatgaagtcagtcgccctggtgatgtc
atcttactttcgccagcggccgcaagttgggaccaatatcctaattttgaagttcgcggc
gatgatttcattaaagctgtcaatcaattaaaagcaacagtcgaaagtggggataagtaa

DBGET integrated database retrieval system