KEGG   Lactobacillus casei BL23: LCABL_20050Help
Entry
LCABL_20050       CDS       T00723                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase (Acetoacetyl-CoA thiolase)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00071  Fatty acid degradation
lcb00072  Synthesis and degradation of ketone bodies
lcb00280  Valine, leucine and isoleucine degradation
lcb00310  Lysine degradation
lcb00362  Benzoate degradation
lcb00620  Pyruvate metabolism
lcb00630  Glyoxylate and dicarboxylate metabolism
lcb00640  Propanoate metabolism
lcb00650  Butanoate metabolism
lcb00900  Terpenoid backbone biosynthesis
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01120  Microbial metabolism in diverse environments
lcb01130  Biosynthesis of antibiotics
lcb01200  Carbon metabolism
lcb01212  Fatty acid metabolism
lcb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LCABL_20050 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    LCABL_20050 (thlA)
   00640 Propanoate metabolism
    LCABL_20050 (thlA)
   00650 Butanoate metabolism
    LCABL_20050 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    LCABL_20050 (thlA)
   00072 Synthesis and degradation of ketone bodies
    LCABL_20050 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LCABL_20050 (thlA)
   00310 Lysine degradation
    LCABL_20050 (thlA)
   00380 Tryptophan metabolism
    LCABL_20050 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LCABL_20050 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LCABL_20050 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LCABL_20050 (thlA)
Enzymes [BR:lcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LCABL_20050 (thlA)
Exosome [BR:lcb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LCABL_20050 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAQ67083
Position
complement(1942625..1943806)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggcgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgttagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system