KEGG   Lactobacillus casei BL23: LCABL_22100Help
Entry
LCABL_22100       CDS       T00723                                 

Gene name
fbp
Definition
(GenBank) Fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
lcb  Lactobacillus casei BL23
Pathway
lcb00010  Glycolysis / Gluconeogenesis
lcb00030  Pentose phosphate pathway
lcb00051  Fructose and mannose metabolism
lcb00680  Methane metabolism
lcb01100  Metabolic pathways
lcb01110  Biosynthesis of secondary metabolites
lcb01120  Microbial metabolism in diverse environments
lcb01130  Biosynthesis of antibiotics
lcb01200  Carbon metabolism
Module
lcb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LCABL_22100 (fbp)
   00030 Pentose phosphate pathway
    LCABL_22100 (fbp)
   00051 Fructose and mannose metabolism
    LCABL_22100 (fbp)
  Energy metabolism
   00680 Methane metabolism
    LCABL_22100 (fbp)
Enzymes [BR:lcb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     LCABL_22100 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2 Metallophos_2
Motif
Other DBs
NCBI-ProteinID: CAQ67277
UniProt: B3W9A8
Position
complement(2143828..2145759)
Genome map
AA seq 643 aa AA seqDB search
MDLYSELTAKYQTVPAIATEIINLEAILNLPKPTEAFMSDIHGEYNAFQHVLRNGSGNVK
SKIRSCFRDEMTEATLQRFAFLVYYPSERMAAIHREMAGDDLQQWYLTTFRRLIRLLAFT
ATKYTRSKVRKAMAPEFVYITEELLYNDADTPDKLAYYWQIIRNLIVLEQADQWIAATCQ
TIQRLTVDHFHVVGDIYDRGPAPDQVVESLIRRDRRHSVDIQWGNHDILWIGAAAGSALC
IANLVRISARYNNLSILEDVYGINLRHLARLAEQYYQDNPAFSPKMERSDRPITEAERLQ
ITQIHQAIAMIQFKLEGPVIKRRPEFDMDHRLVLEKLAPDFSTIKLNGDTYTIENGCFAT
VDPADPYKLLPEEQEVIDSLVESFTHSEKLHRHMDFLLDHGSMYLRYNRNLLLHGCVPVD
EDGNFIGLTIKGTTYTGRQLFDMLEANLRLAYSQPTENADLATDLMWYLWTGPNSPLFGK
HDMTTFERYFISDPKAHVEGRNPYYHLRKDPEFIKKILAEFVLDPEVGHVINGHTPVKKG
TDPIMANNKMIVIDGGFSKPYQKTTGIGGYTLLDNSYGMQLVTHQPFTTKADAIANLTDI
ISTRRVVETEARRRTVAETDIGTELQDEVEVLKRRLGELREEE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggacttgtacagtgaactgacggcgaagtatcaaacggtgccagcgattgcgactgaa
atcattaatctggaagccattttgaatttacctaagccgacggaagcgtttatgagcgat
atccacggggagtataacgcctttcagcatgttttgcggaacggcagcgggaatgtgaaa
agcaaaattcgttcctgttttcgcgatgaaatgacggaggcgaccctgcagcgcttcgct
tttttggtgtactatccgtctgagcgaatggcggcgattcatcgggagatggcaggggat
gacttgcaacagtggtatttgacgacttttcgccggttgattcgcttgctggcgttcacc
gcgaccaaatacacgcgttcgaaagttcgcaaggcgatggcaccggagtttgtctatatc
accgaagagttgctgtacaatgatgccgatacgcctgacaagctggcttattattggcaa
attattcgtaatttaatcgttcttgaacaggccgatcagtggattgcggcaacgtgtcaa
acgattcaacgtttaacggtagatcattttcacgttgtaggcgatatctatgatcgagga
ccggcgccggatcaggtggttgaaagcttgattagacgtgatcggcgtcattcagtggat
attcaatggggcaaccatgatattctttggatcggcgccgccgcgggctcggctttgtgc
attgccaatttggtgcggatttccgcgcggtataacaatttaagtattctcgaagatgtt
tatgggattaatttgcggcatttggcccgattagcggaacaatactatcaagataatccc
gccttttcaccaaaaatggagcggtcagatcgaccaataactgaggcggagcgacttcaa
attacgcagattcatcaggcgattgcgatgattcaatttaagttggaaggaccagtgatt
aaacgtcggcctgaatttgacatggatcatcggctagtgctggagaaactggcacctgat
ttttcaaccatcaagttgaatggtgatacttatacgattgaaaacggctgttttgcgacg
gttgatccggctgatccttacaagttgttgccagaggagcaagaggtcattgactcgctg
gttgagtcctttacgcactctgaaaagttgcatcgccacatggattttctacttgatcac
ggcagtatgtatttgcggtacaaccggaatttgttgctgcacgggtgtgtgccggtggac
gaggatggcaattttattggcttgaccattaaagggacgacttatactggccgtcaacta
tttgacatgctggaagcaaatcttcggttggcatacagtcaaccaacggagaatgctgac
ttagcaaccgatctgatgtggtatctctggaccggtccaaattcaccgctttttggcaag
cacgacatgacgacctttgaacgctatttcattagcgatccgaaagcccatgtcgaaggc
cgtaatccgtattatcacctgcgtaaggacccggaatttatcaaaaagatcttggcggaa
tttgtcctcgatcctgaagtcggccatgtcattaatggtcatacgccagtcaaaaaaggc
accgaccccattatggcaaacaacaaaatgatcgtcatcgacggcggcttttctaaaccg
tatcaaaaaaccaccgggatcggcggttacacgcttttggataattcttatggtatgcaa
ctagtgacgcaccaaccattcaccacaaaagccgatgctatcgccaaccttactgatatc
atttcaacccgtcgcgtcgtcgaaaccgaagcccgccgccgaacggtagcagaaactgac
attggcactgagctacaggatgaggttgaggtgttgaagcggcgattgggtgagttgcgg
gaagaagaatag

DBGET integrated database retrieval system