KEGG   Liberibacter crescens: B488_01880
Entry
B488_01880        CDS       T02395                                 

Definition
(GenBank) hypothetical protein
Organism
lcc  Liberibacter crescens
SSDB
Motif
Pfam: DUF4354 DUF4352
Other DBs
NCBI-ProteinID: AGA64181
UniProt: L0EUW8
Position
complement(228554..228934)
AA seq 126 aa
MKKSYLLLYPICFLFSIAASSVPPEVIVYAKQKETGSIFSPHKFTYTKDFDVTVVNFSQG
EIDLSKYCFKAMLGMKEFNVDTIDEKLASKKLKNGERLRGVVVFSSNNSDVTQANIVQLT
DKCKKN
NT seq 381 nt   +upstreamnt  +downstreamnt
atgaaaaaatcgtatttattattatatcctatctgttttttgttttcaattgcagcttct
tctgtacctccagaagttattgtatatgctaaacaaaaagaaacaggaagtatttttagt
ccacacaagtttacttatacaaaagatttcgatgtcactgtagttaacttttctcaagga
gagattgatctctctaagtattgttttaaagccatgctaggaatgaaagaattcaatgta
gatactattgatgaaaaattagcctctaaaaaactaaaaaatggcgaacgccttagagga
gttgtcgtgttttcatccaataatagcgacgttacacaagcaaacatagttcaattaaca
gacaaatgtaaaaaaaattaa

DBGET integrated database retrieval system