KEGG   Liberibacter crescens: B488_13550Help
Entry
B488_13550        CDS       T02395                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
lcc  Liberibacter crescens
Pathway
lcc00010  Glycolysis / Gluconeogenesis
lcc00020  Citrate cycle (TCA cycle)
lcc00620  Pyruvate metabolism
lcc01100  Metabolic pathways
lcc01110  Biosynthesis of secondary metabolites
lcc01120  Microbial metabolism in diverse environments
lcc01130  Biosynthesis of antibiotics
lcc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B488_13550
   00020 Citrate cycle (TCA cycle)
    B488_13550
   00620 Pyruvate metabolism
    B488_13550
Enzymes [BR:lcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     B488_13550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_24 AAA_33
Motif
Other DBs
NCBI-ProteinID: AGA65347
UniProt: L0EWK6
Position
complement(1474542..1476155)
Genome map
AA seq 537 aa AA seqDB search
MKEIGLHNLDIQKKTFELEDAACVYYNLNTNMLYEESIRRCESNLTSNGVMRVITGHHTG
RSPKDKFILKDDITCSTVFWENNNAISIEHFSLLKTDMLEYIKGKELFVQDLIACNNPKH
ELPVRVITELCWHSLFIRNLLISLDRKKLSSFVPQLTIIDIPSFNANPDRHGCRSKTVIA
VDLKNGIVLIGGTSYAGEIKKSVFTFLNYIFPKKGIMPMHCSANVGKEGDVALFFGLSGT
GKTTLSADSSRVLIGDDEHGWADNGIFNFEGGCYAKTINLSEKVEPEIFSAAQRFGTVLE
NVVIDDDGVPDFKDSSFTENTRAAYPLCFIKNSSDVGMAAHPKNVIMLTADAFGVLPPVS
RLTPEQAMYYFLSGYTAKVSGTEKGILEPEATFSTCFGAPFMPRHPVEYGNLLKDFIIRH
NVRCWLVNTGWIGGPYGIGKRISIVVTRAILKAIFEESIHESSYRIDKNFGFSVPLEIIG
VDKNILDPRLIWSNSDDYDVQSEKLISMFSDNFVKFESSVDNSILSSAVKKKSKKTL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaataggtcttcataatctcgatattcagaaaaaaactttcgaattagaagat
gcagcgtgtgtttattataatcttaatacaaatatgttgtatgaagagtctattcgtcgg
tgtgaaagtaatctcacttctaatggagtaatgagagtaattacaggacatcacacgggt
cgttctcctaaagataagtttatattaaaagacgatattacttgtagtacagtattttgg
gaaaataataacgcgatatctattgaacatttttctttattaaaaactgatatgttagaa
tatatcaaaggtaaagaattatttgtacaagatttaatagcttgtaataatccaaaacat
gaattacctgttcgggttataactgagctttgttggcattctttgtttattcgaaatctt
ttaatatctcttgataggaaaaaactatcttcttttgttccacagctgacaattattgat
attccaagttttaatgctaatcctgatcgacatggatgtcgatcaaaaactgtgatagca
gttgatcttaaaaatggtattgttttaattggtggtacttcatatgctggagaaataaaa
aaatctgtatttacatttcttaattatatttttccaaaaaaagggataatgccgatgcat
tgttctgcaaatgttggtaaagagggtgatgttgccttgttttttggtttatctggaaca
ggaaaaacgactctttcagcagattcatcacgtgttcttattggagatgatgaacatgga
tgggctgataatggtatttttaactttgaaggtggttgttatgctaaaacaatcaatctt
tctgaaaaggtagagccagagattttttctgctgcacaacgttttggtacagttcttgaa
aatgttgttattgatgatgacggtgtaccagattttaaggatagttcatttacagaaaat
acccgtgctgcctatccactttgttttattaaaaactcttcagatgtaggcatggcagcg
catccgaaaaatgtcataatgttaactgcggatgcatttggagttttaccccctgtttcc
aggttaacgcctgagcaggctatgtactattttctttctgggtatactgctaaagtttct
ggtacagagaaaggtatcttggagccagaagctactttttcaacttgttttggtgcacct
tttatgccacgccatcctgttgaatatggaaatttacttaaagattttattataaggcat
aatgttcgttgttggcttgtaaatactggttggattggtggtccttatggtataggtaag
cgaatatccattgtagtaacccgcgcgatcttgaaagcaatttttgaagaaagcattcat
gaatctagttatcgtatagataaaaattttggtttttctgttcctttagaaataatcggg
gttgataaaaatattttagatcctcgattaatttggagtaatagcgatgactatgatgtg
caatcagaaaaactgatatcaatgttttctgataattttgttaaatttgaaagtagtgtt
gataattctattctatcaagcgcagttaagaaaaaaagcaagaaaactttataa

DBGET integrated database retrieval system