KEGG   Legionella clemsonensis: clem_03885Help
Entry
clem_03885        CDS       T05016                                 

Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00360  Phenylalanine metabolism
lcd00362  Benzoate degradation
lcd01100  Metabolic pathways
lcd01120  Microbial metabolism in diverse environments
lcd01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    clem_03885
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    clem_03885
   00622 Xylene degradation
    clem_03885
   00621 Dioxin degradation
    clem_03885
Enzymes [BR:lcd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     clem_03885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like
Motif
Other DBs
NCBI-ProteinID: ASQ45335
UniProt: A0A222P0L6
Position
882608..883498
Genome map
AA seq 296 aa AA seqDB search
MSKRNILKPANYMKTIEILDVSLRDGGHRTNFHFSDQELQHILTALDKSGIEYIEIGYRN
GLAGLASPVGRAGLCERDYLYFCQSLIKHAKIAVMIHPQNILESDLLELKKCGVTLIRVC
VLKDKLIDALSFFKKVKNLSLKLSINFTNMSHYQPAELDGLIKQIIQFEPDMIYFADSNG
SITPEKISMIYQKYTQQYAIPFGFHAHDNLGLAQANALAAIHSGATFIDASLAGMGKGIG
NLKTEFFAAYLQATKTKTYNLAELLTASNYVRHALGIGHEPIEWDEFNRGISDPAY
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacgtaatattttaaaaccagcaaattatatgaaaacaattgaaattctggat
gtctctttaagagatggtgggcatagaacaaattttcattttagtgatcaggaattgcaa
catatcttaactgccctcgataaatccggtattgaatatattgaaattggctatcgtaat
gggcttgcaggtttagccagtcccgttggaagagcgggattgtgtgaaagagattacctt
tatttttgtcaatccttaatcaagcacgcaaaaattgccgtcatgattcatccgcaaaat
attttagagtcagatctcttagaattgaaaaaatgcggggtcacattaatccgggtctgc
gtccttaaagataaattgattgatgcgctatcgttttttaaaaaagtgaagaatttatct
ctgaaactttctattaattttaccaatatgtcgcactaccagccagccgaactggatgga
ctgataaaacaaatcattcagtttgagccagatatgatttattttgcggattcaaatgga
agtattactcctgaaaaaattagtatgatttaccaaaaatacacgcagcaatatgctatt
ccattcggttttcatgctcatgataatcttggtctggcacaggcaaatgccttggcggct
attcactctggggctacatttattgatgcttctttggctggtatgggaaaaggaatcggg
aatttaaaaacggaattttttgctgcttatttacaagccacaaaaacaaaaacatataat
cttgcagaattattaacagcttcaaattatgtccgtcatgcgctaggtattggacatgaa
cccattgaatgggatgaattcaatcgcggtatttctgatcccgcttattaa

DBGET integrated database retrieval system