KEGG   Legionella clemsonensis: clem_07195Help
Entry
clem_07195        CDS       T05016                                 

Gene name
pcaF
Definition
(GenBank) Beta-ketoadipyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00071  Fatty acid degradation
lcd00072  Synthesis and degradation of ketone bodies
lcd00280  Valine, leucine and isoleucine degradation
lcd00310  Lysine degradation
lcd00362  Benzoate degradation
lcd00380  Tryptophan metabolism
lcd00620  Pyruvate metabolism
lcd00630  Glyoxylate and dicarboxylate metabolism
lcd00640  Propanoate metabolism
lcd00650  Butanoate metabolism
lcd00900  Terpenoid backbone biosynthesis
lcd01100  Metabolic pathways
lcd01110  Biosynthesis of secondary metabolites
lcd01120  Microbial metabolism in diverse environments
lcd01130  Biosynthesis of antibiotics
lcd01200  Carbon metabolism
lcd01212  Fatty acid metabolism
lcd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    clem_07195 (pcaF)
   00630 Glyoxylate and dicarboxylate metabolism
    clem_07195 (pcaF)
   00640 Propanoate metabolism
    clem_07195 (pcaF)
   00650 Butanoate metabolism
    clem_07195 (pcaF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    clem_07195 (pcaF)
   00072 Synthesis and degradation of ketone bodies
    clem_07195 (pcaF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    clem_07195 (pcaF)
   00310 Lysine degradation
    clem_07195 (pcaF)
   00380 Tryptophan metabolism
    clem_07195 (pcaF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    clem_07195 (pcaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    clem_07195 (pcaF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    clem_07195 (pcaF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lcd04147]
    clem_07195 (pcaF)
Enzymes [BR:lcd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     clem_07195 (pcaF)
Exosome [BR:lcd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   clem_07195 (pcaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASQ45994
UniProt: A0A222P2A9
Position
complement(1635995..1637314)
Genome map
AA seq 439 aa AA seqDB search
MKLKSNLSGREVYIVDGSRTPFLKAKGVGPFTGSDLAVAAGMPLLNRQPFLPTDLDEVII
GSAMPGPDEANIARVVALRLGCGEKVPAFTVMRNCASGMQALDNAAMQIASGRSDLVLAG
GTEAMSHAPLLFNQKMASWLASWFAAKSMGQRAVLMTKFRPSFLAPVIALLRGLTDPIVG
LNMGQTAERVAYRFNITREQMDAFACESHRRLAAAYAEGRMEEVVPIIDSKGRVYPQDDG
IRADSTVEKLAKLKPYFDKKYGMVTAGNSSQVTDGACLLILASADAVKKYNLSVIGRIVD
SQWAALDPSQMGLGPVHAATPIMQRHNLKPADFDCWEINEAFAAQVLGCLAAWEDEEYCR
TQLGLKQAMGAPSLGRLNMDGGAIAAGHPIGASGARIVLHVLQGLKHHNGSRGMAAICIG
GGQGGAMYLERVTEVKGHE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcaaatcgaatttaagcggcagagaggtatatatagttgatggtagtcggaca
ccatttcttaaggcaaaaggagtaggtccttttactggttcagatttggccgttgcggcg
ggtatgccattgttaaatcgccagccttttttacctactgacctggatgaggtaatcatt
ggttctgccatgccaggccctgatgaagcaaatattgccagagtagtggctttgcgtctt
ggctgtggagaaaaagttccagcatttactgtcatgaggaattgtgcttccggtatgcaa
gcacttgacaatgctgctatgcagattgccagtggtcgtagtgacttggttcttgctgga
ggtactgaagcaatgagtcatgcgcctttattgttcaatcaaaaaatggcctcatggcta
gccagttggtttgccgccaaaagtatgggacaacgggcagtactaatgactaaattcaga
ccttccttcctggccccggttattgccttgttgcgtggtttaactgatcccattgttggc
ttgaatatgggccaaactgctgaaagagttgcctatcgttttaacattactcgtgaacaa
atggatgcttttgcttgtgaaagtcatcgacgattggccgctgcttatgcagaaggacga
atggaagaagttgttccgatcattgatagcaaagggcgagtttatcctcaagatgatgga
atacgtgccgattcaaccgttgagaaactggcaaagctaaaaccttattttgataaaaaa
tatggtatggtaaccgcaggtaatagttcacaggttactgatggtgcttgtttactaatt
ttagcgagtgctgatgcagttaaaaaatataatttatctgtaataggacgtatagtagat
tcacaatgggctgctctcgatccatcgcaaatggggttaggacctgtccatgcggccaca
cctattatgcagcgtcacaatttaaaacctgcggattttgactgttgggaaattaatgag
gcgtttgctgcacaagttttaggttgtctggcagcttgggaagatgaagaatattgccgt
acgcagttaggtttaaaacaagcaatgggtgcgccatcattaggtcgattaaatatggat
ggtggtgcaatagcggcgggacacccaataggtgcaagtggggctcgcattgtattacat
gtgcttcaaggactaaaacaccataatggaagtcgaggtatggctgctatctgtataggt
ggcggacaagggggagcaatgtatctggaacgtgtgacagaggtgaaaggacatgagtaa

DBGET integrated database retrieval system