KEGG   Legionella clemsonensis: clem_10755Help
Entry
clem_10755        CDS       T05016                                 

Gene name
phhA
Definition
(GenBank) Phenylalanine-4-hydroxylase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00360  Phenylalanine metabolism
lcd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lcd00790  Folate biosynthesis
lcd01100  Metabolic pathways
lcd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    clem_10755 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    clem_10755 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    clem_10755 (phhA)
Enzymes [BR:lcd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     clem_10755 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: ASQ46697
UniProt: A0A222P4E6
Position
complement(2413653..2414471)
Genome map
AA seq 272 aa AA seqDB search
MEFVSRYVSHQPDANGMVDYSNEEHRIWQVLYERQMKIIPDRACDEFIQGLKSLGLSADK
IPQLPEVSSRLKALTGWEVAPVAALISAREFFQLLAERRFPAATFIRCEEELNYVQEPDI
FHEIFGHCPMLTDPVYADFVCNYARKVLSLDEDQWPLLQRLFWFTVEFGLIKTPQGLRAY
GGGILSSISETPYSVESDAAMRVLFDPVVAFRMPYRIDILQPVYFVIDNYQMLYNFVEAD
IIAFIERARELGEYPPIFPVDKNNPSVHILAC
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggaatttgtcagtcgttatgtttctcatcaacctgatgccaacggtatggtagattat
agcaatgaggagcatcgtatttggcaagtgctttatgaacgccaaatgaagattattcct
gacagggcttgcgatgaatttattcaagggttgaaaagtctgggtttgtctgctgataaa
attccgcagctacctgaagtgagctctcgacttaaagcattaaccggttgggaagttgct
ccagtggcggctctaatttcggcaagagaattttttcaattattggcagagagacgtttt
cctgcagccacttttattcgttgtgaagaagaacttaattatgtgcaagagcctgatatc
tttcatgagatcttcggtcattgcccgatgttaactgatccagtttacgcggattttgtc
tgtaattatgcccgtaaggttctaagtttagacgaagaccaatggcccttattgcaaaga
cttttctggtttacggtagagtttggtcttatcaaaacacctcaaggattgcgtgcttat
ggaggaggtattttgtcttcaattagtgaaacaccctatagtgtggaaagtgatgcagcc
atgcgcgtactttttgatcctgttgttgcatttcgtatgccctatcggatcgatatctta
caacccgtttattttgtaattgataattatcaaatgctttataattttgtcgaggcagat
ataatcgcttttattgagcgggccagggaattaggtgaatatcctcctattttccctgtt
gataaaaataatcccagcgttcatattctggcgtgctaa

DBGET integrated database retrieval system