KEGG   Legionella clemsonensis: clem_12125Help
Entry
clem_12125        CDS       T05016                                 

Gene name
cfiA
Definition
(GenBank) 2-oxoglutarate carboxylase large subunit
  KO
K01960  pyruvate carboxylase subunit B [EC:6.4.1.1]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00020  Citrate cycle (TCA cycle)
lcd00620  Pyruvate metabolism
lcd01100  Metabolic pathways
lcd01120  Microbial metabolism in diverse environments
lcd01200  Carbon metabolism
lcd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    clem_12125 (cfiA)
   00620 Pyruvate metabolism
    clem_12125 (cfiA)
Enzymes [BR:lcd01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     clem_12125 (cfiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 GCV_H HlyD_D23 AIM24
Motif
Other DBs
NCBI-ProteinID: ASQ46961
UniProt: A0A222P534
Position
complement(2712304..2714106)
Genome map
AA seq 600 aa AA seqDB search
MSTVHITDVTLRDAHQCLIATRMRTEDMLPVCPKMDKVGFWAMEVWGGATFDACLRFLKE
DPWARLRLLREALPNTRLSMLLRGQNLLGYRHYADDVVQAFVKLASRNGIDVFRVFDALN
DVRNLRVALEAVKANKKHAQGTICYTTSPVHTLESFVDLGKALAEMGCDSIAIKDMAGLL
TPTATVNLYEALAQATQLPIHLHSHATSGLASMCHYEAIVAGCTHVDTAISSFSGGASHP
ATESLVAALAGTEFDTGLDLNRLLDIGEYFKKIRKKYHQFEGEAREIDPRVQVYQVPGGM
ISNLYSQLKEQQALDKINAVHAEIPRVRRDLGYPPLVTPTSQIVGTQAVMNVLTGERYKT
ITNEVKLYCQGKYGAAPGKISPGLRKKAIGHTEAIDVRPADLIPHELNRLRQEIGELAES
DEDVLSYAMFPEIGKQFLEQRKNNSLQPEPLIPEPAANTNGNLSEFEITLHGESYHVKIA
GYGEREQGQQACFLWVDGVPEEVILLEQNEAGEEEQSTANASKKKNGPGDITVAMPGSIV
NITVEAGQKVKAKETLLVLEAMKMETEIQAPFDGVVTAIFCEKGDKVTPAQVLLHLEKES
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgtacacataactgatgttactctgcgtgatgctcatcaatgtttgatagcg
acacgaatgcgcactgaagatatgctgcctgtctgtcctaaaatggataaagttggtttt
tgggcgatggaagtatggggtggggcgacctttgatgcttgtttgcgctttttgaaggaa
gatccatgggcgcgtttgcgcctgttacgagaagcactgcccaatacgcgtttatccatg
ttattgcgtggtcaaaacctcttagggtatcgacattatgcggatgatgtagtgcaagca
tttgttaaattggcttccagaaatggtattgatgttttccgggtttttgacgcattaaat
gacgttcgtaatctgcgtgtagcacttgaagcagtaaaggctaacaagaaacacgcgcag
ggcacaatttgttatacaacaagcccggttcatacgcttgaaagctttgttgacttaggc
aaagcactggctgaaatgggttgtgacagtattgcaatcaaggacatggcaggcttatta
acccccacggccacggtgaatttatatgaagcattggcacaggcaacacaattgcctatc
catcttcatagccatgccacctctggtcttgccagcatgtgtcattatgaagctattgtt
gcaggctgcacgcatgttgatacagccatctcctccttttcaggtggcgcttctcacccc
gcgacagagtctttggtagccgctttggcgggaacagaatttgatacgggtctggattta
aatcgattactggatatcggggagtattttaaaaaaattcgcaaaaaatatcatcagttc
gaaggtgaggcgcgtgagattgatcctcgggtgcaggtttatcaagttcccggaggcatg
atttcgaatttatacagtcaactaaaggaacagcaggcacttgataaaattaatgcggta
catgcggaaattccgcgggttcggcgtgatttgggataccctcctttagtgactcctact
tcacaaattgtgggcacccaggcggtgatgaatgttctgacgggcgagcgctataaaacc
attaccaatgaagttaaattgtattgccagggtaaatatggcgcggctcctgggaaaatt
agccctggtttgcgtaagaaagccataggacatactgaggccattgatgtaagaccggca
gatctaatccctcatgagttaaaccgtctacgtcaagaaattggagagttggccgaaagt
gatgaagatgttctttcttatgccatgttccctgaaattggaaagcaatttctagaacag
cgtaaaaataattcactgcaacctgaaccactcattcctgagcctgcagcaaacaccaat
ggaaatttatcggagtttgaaattacgctacatggagaaagttatcatgtgaaaatagcg
ggttatggagagcgtgagcaagggcaacaggcttgttttttgtgggtagatggtgtacct
gaagaagtcattcttttagagcagaacgaagcaggggaggaggaacagtcgactgctaat
gcaagtaagaaaaaaaatggtccaggtgacattactgtggctatgccagggtctattgtt
aatattacagtcgaggccggacaaaaagtaaaagctaaagagacactgcttgttcttgaa
gccatgaaaatggaaacagagattcaagcgccctttgatggtgtcgtgacggctattttt
tgtgaaaagggggataaagtgacgcctgcgcaagtattgctgcatttggagaaggaaagc
tag

DBGET integrated database retrieval system