KEGG   Legionella clemsonensis: clem_14265Help
Entry
clem_14265        CDS       T05016                                 

Gene name
metG_2
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lcd  Legionella clemsonensis
Pathway
lcd00450  Selenocompound metabolism
lcd00970  Aminoacyl-tRNA biosynthesis
lcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    clem_14265 (metG_2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    clem_14265 (metG_2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lcd01007]
    clem_14265 (metG_2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lcd03016]
    clem_14265 (metG_2)
Enzymes [BR:lcd01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     clem_14265 (metG_2)
Amino acid related enzymes [BR:lcd01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   clem_14265 (metG_2)
Transfer RNA biogenesis [BR:lcd03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    clem_14265 (metG_2)
 Prokaryotic type
   Other AARSs
    clem_14265 (metG_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Zn_Tnp_IS1595 tRNA-synt_1e tRNA-synt_1d
Motif
Other DBs
NCBI-ProteinID: ASQ47379
UniProt: A0A222P6B8
Position
complement(3149740..3150342)
Genome map
AA seq 200 aa AA seqDB search
MTTVRKMLVTSALPYANGHLHLGHLVEHIQTDIWVRTHKMLGHACISVCGDDAHGTPIML
KAEQLGITPEELTTQIKKSHEQDFKAFAIDYDCYHTTHSEENQWLASQIYQQLQDSGDIV
KKTIRQAYDPVKQMFLPDRYVKGTCPKCGSLDQYGDNCESCGATYSPTDLIDAVSAISGA
KPIEKDSEHYFLIYLAMKRC
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgttcgtaaaatgctggtaaccagtgcattgccctatgctaatggtcatttg
catctgggtcatttggtagagcatattcaaacggatatatgggtgcgtacccataaaatg
ctcggacatgcctgtatcagtgtctgtggggatgatgcccatggcactcccattatgcta
aaagctgaacagttgggtataacgcctgaagaattaaccactcagataaaaaaaagccat
gaacaagatttcaaggcctttgctattgattatgactgttatcacaccacccactctgaa
gaaaatcagtggttggcaagccaaatctatcaacagttgcaggattcaggggatattgtt
aaaaaaaccattcgccaagcctatgatcccgtcaaacaaatgttcctgcctgatcgctat
gtgaaaggaacctgtcctaaatgtggttctttggatcaatatggggataactgtgaatct
tgtggcgcaacctattcaccaactgatttaattgatgctgtctctgccatttcaggtgcc
aagcccattgagaaagattcggaacattattttttgatttacctcgctatgaagcgttgt
taa

DBGET integrated database retrieval system