KEGG   Lactobacillus casei LC2W: LC2W_1962Help
Entry
LC2W_1962         CDS       T01956                                 

Gene name
atoB2
Definition
(GenBank) Acetyl-CoA C-acetyltransferase thil
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00071  Fatty acid degradation
lce00072  Synthesis and degradation of ketone bodies
lce00280  Valine, leucine and isoleucine degradation
lce00310  Lysine degradation
lce00362  Benzoate degradation
lce00380  Tryptophan metabolism
lce00620  Pyruvate metabolism
lce00630  Glyoxylate and dicarboxylate metabolism
lce00640  Propanoate metabolism
lce00650  Butanoate metabolism
lce00900  Terpenoid backbone biosynthesis
lce01100  Metabolic pathways
lce01110  Biosynthesis of secondary metabolites
lce01120  Microbial metabolism in diverse environments
lce01130  Biosynthesis of antibiotics
lce01200  Carbon metabolism
lce01212  Fatty acid metabolism
lce02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lce00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LC2W_1962 (atoB2)
   00630 Glyoxylate and dicarboxylate metabolism
    LC2W_1962 (atoB2)
   00640 Propanoate metabolism
    LC2W_1962 (atoB2)
   00650 Butanoate metabolism
    LC2W_1962 (atoB2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LC2W_1962 (atoB2)
   00072 Synthesis and degradation of ketone bodies
    LC2W_1962 (atoB2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LC2W_1962 (atoB2)
   00310 Lysine degradation
    LC2W_1962 (atoB2)
   00380 Tryptophan metabolism
    LC2W_1962 (atoB2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LC2W_1962 (atoB2)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LC2W_1962 (atoB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LC2W_1962 (atoB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lce04147]
    LC2W_1962 (atoB2)
Enzymes [BR:lce01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LC2W_1962 (atoB2)
Exosome [BR:lce04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LC2W_1962 (atoB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AEA54294
Position
complement(1903713..1904894)
Genome map
AA seq 393 aa AA seqDB search
MEEVVILSAKRTPIGKLGGDLAGASAVDLGVAAAQAAIKAARIDPALLNQAIFGNVMQAG
SGQNVARQIGLKSGMATSSTAMTVNEVCGSGLKAVRLGQAAIQLGEADAVLVGGTESMSQ
VPYYAEAVRSGHKFGDTTLVDGLSRDGLNDAFSQQPMGITAENVATQFNVSRQEQDEFAL
RSHLRAAAAAAEGRFKSQIAPVTIAARHGDVIVDRDSAIRPDTSLAKLAQLPPVFEVGGT
VTAGNASGINDGAAALILMAKSKAEQLGLHYLATITGFAEVGIDPAIMGYAPKLAIDKIL
QATGGSIAAIDQIELNEAFASQSVAVARDLGLKDEQFNINGGALALGHPLGASGARILIS
LLYDLAERNQRQGIAALCVGGGIGIAMQIAMHV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagttgtgattctaagtgccaaacggacgccgattggtaagttgggtggtgat
ttggctggcgccagtgccgttgatttaggggttgcggcagcgcaggcggcaattaaggct
gcacgaattgacccagcgttactcaatcaggcgatctttggtaatgtcatgcaggctggt
tctgggcagaatgttgcccgacaaatcggattaaaaagcggtatggccactagcagcacg
gcgatgactgtcaatgaagtctgcggctcaggcctgaaggcagtgcggcttgggcaagct
gccattcaactcggcgaggctgacgcggtgcttgtgggcggtaccgaaagcatgagtcaa
gtaccttattacgccgaagcggttcgttcaggccacaaatttggcgatacaacgctggtc
gacggtttgagtcgcgatggattaaatgatgccttcagtcagcagccaatgggaatcacg
gcggaaaatgtggcgacacaatttaacgttagtcgtcaggagcaagatgagtttgctctc
cgttcgcatttacgcgccgcggccgccgcagctgagggtcggtttaagagtcagatcgcc
ccagtgacgattgctgcccgtcacggggatgtcatcgtagatcgtgattcagccattcgg
cccgatacgtcattggctaaattagcccaattaccgcctgtttttgaagtcggcggtact
gttacagcaggtaacgcaagcggcattaatgatggcgcagccgccttgatcctgatggca
aaatcgaaagccgaacaactggggctccattatttagcgacgatcactggttttgccgag
gtgggtattgatccggcaattatggggtatgcgccaaaactggcgatcgataaaatactg
caggcaaccggcggctctatcgcggcaattgatcaaattgaattgaatgaagcatttgcc
tcacaaagcgttgctgtggctcgtgaccttggtttaaaggatgaacaattcaatatcaat
ggtggcgccttagcgttgggtcatccattgggagcttcaggtgcccgaattttaatctca
ttattgtacgatctggctgaacgtaatcaacgccaaggcattgccgcattgtgcgttggc
ggtggcatcggtatcgccatgcaaatcgcgatgcatgtctga

DBGET integrated database retrieval system