KEGG   Lactobacillus casei LC2W: LC2W_2757Help
Entry
LC2W_2757         CDS       T01956                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
lce  Lactobacillus casei LC2W
Pathway
lce00450  Selenocompound metabolism
lce00970  Aminoacyl-tRNA biosynthesis
lce01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lce00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LC2W_2757
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LC2W_2757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lce01007]
    LC2W_2757
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lce03016]
    LC2W_2757
Enzymes [BR:lce01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LC2W_2757
Amino acid related enzymes [BR:lce01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LC2W_2757
Transfer RNA biogenesis [BR:lce03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LC2W_2757
 Prokaryotic type
   Other AARSs
    LC2W_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AEA55086
Position
complement(2682818..2684800)
Genome map
AA seq 660 aa AA seqDB search
MASKPTFYVTTPIYYPSGKLHIGNAYTTIAADVLARYKRLMGYDVFFLTGTDEHGLKIEQ
KADKLGVTPQAYVDGMATQIKQLWKMLEITNDKFIRTTDKEHVEAVQTIVERLIKQGDVY
LGEYTGWYSVEDEEYFTESQLSEVYRDQDGNVTGGKAPSGHEVQLVHEPSYFFKMSKYTD
RLLKYYDEHPDFVQPASRKTEMINNFIKPGLEDLAMSRTSFNWGVQIPSDPKHVVYVWVD
ALLNYITALGYGSNDHALFDKYWPANVQLIGKEIVRFHIIYWPIILMALGLPLPKKIYAH
GWLVMKDGKMSKSKGNAIYPDMIVERYGLDALRYYLMRAIPFGNDGIFTPEDFIDRINYD
LANDLGNLLNRTIAMINKYEDGILPAFKPDVTPFDQDLGDVAQAALAQYHKLMDELRFSD
ALDQVWKIVSRANKYIDETEPWNLAKDPAKKDQLDAVMAHLAESLRLIALLIQPVMTHAP
LQIFGQLGLDHENDDHKLVQWGALPAGVKVVEQGTPIFPRLDTEEEVAYIKSKMTPGTTK
ATIDEKTRKSEIEFKQFDKSEIRVAEILNVEPVKGADKLLKFTLDAGDEGTRQILSGIRE
FYPDYEKLKGKKVMAVVNLKPRKLKGEMSEGMLLSAESLDGKKITLLEVSENLENGSLVG
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaaccaactttttacgtaacaacaccaatttattacccatctggcaaacta
catatcggcaatgcctacaccaccattgcagcagacgtgctcgcacggtataagcggctc
atgggctacgacgttttcttcctaactgggaccgacgaacatggcctgaaaatcgagcaa
aaggctgataagttaggggtgacgccacaagcttatgttgatggcatggcgacccaaatc
aagcaactttggaaaatgcttgaaatcaccaatgacaagtttatccggaccactgacaag
gaacatgtcgaagccgttcaaacgattgtggaacgtctcatcaaacaaggggacgtctat
ttaggcgaatacactggctggtactccgttgaagacgaggaatacttcacggaatctcaa
ctgtcggaagtttatcgcgatcaagacggcaacgtgaccggcgggaaagcgccgtctggt
catgaagtgcagctggttcacgaaccaagctactttttcaagatgagcaagtacaccgat
cgcttgttgaagtattatgacgagcatccggattttgttcaaccggcttcacgcaaaact
gaaatgatcaataactttatcaaaccgggtctggaagatctggcgatgagccggacgagc
ttcaattggggtgtccagattccatccgatccgaagcacgttgtttacgtgtgggttgat
gcgttgctgaactatattaccgccctaggctatggcagtaatgatcacgctttgtttgac
aaatactggccagccaacgtccaattgattggtaaggagattgttcgtttccacattatc
tattggccaattattttaatggcactcggcttgccgttgccaaagaaaatttatgcccat
ggctggctagtcatgaaagatggcaaaatgagtaagtcgaaaggcaatgccatttatccg
gacatgattgttgaacgttatggcttggatgcattgcgatattacttgatgcgcgccatt
ccatttggtaatgatggcattttcacaccagaagacttcattgaccggatcaattacgac
ttggccaatgacctcggtaatctgttgaatcggaccattgccatgattaacaagtatgaa
gacggtattttgccagcctttaaaccggatgtaacgccgtttgatcaagatcttggcgat
gtggcgcaggcggctttggcgcaatatcacaaattgatggacgagttgcgtttctccgat
gctttggatcaagtctggaaaattgtttcccgggcgaacaagtatatcgacgaaacggaa
ccgtggaatctggccaaagatcctgccaaaaaagatcagcttgatgctgtgatggctcac
ttggccgaaagtctgcgtctgattgctctactgattcaaccagtgatgacccatgcaccg
ttgcaaatcttcggccaacttggcttggatcatgaaaatgacgatcacaagcttgtccaa
tggggcgcgttgccagctggtgtcaaagtagttgaacaaggcacgccaatcttcccgcgt
cttgatacggaagaagaagtggcatatatcaagagcaagatgacccccggcaccacgaaa
gccactatcgacgaaaaaactcggaagtcagaaatcgagttcaaacaattcgataagagc
gaaattcgggtcgcagaaattttgaatgtcgaaccggttaaaggtgctgacaaactgttg
aagttcacgctcgatgctggcgatgaaggcacacggcaaattctttccggcattcgggaa
ttttacccagattacgagaagctaaaaggtaaaaaggtcatggctgtggtcaacttgaag
ccgcgcaagctaaaaggcgaaatgtctgaaggtatgttgttgtcggctgaaagtttagac
ggcaagaaaatcactttgctggaagtctctgagaacttagagaatggcagcttggttggt
taa

DBGET integrated database retrieval system