KEGG   Lates calcarifer (barramundi perch): 108872574Help
Entry
108872574         CDS       T04895                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
lcf04060  Cytokine-cytokine receptor interaction
lcf04068  FoxO signaling pathway
lcf04110  Cell cycle
lcf04218  Cellular senescence
lcf04350  TGF-beta signaling pathway
lcf04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108872574
   04350 TGF-beta signaling pathway
    108872574
   04068 FoxO signaling pathway
    108872574
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108872574
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    108872574
   04218 Cellular senescence
    108872574
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    108872574
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lcf04052]
    108872574
   00536 Glycosaminoglycan binding proteins [BR:lcf00536]
    108872574
Cytokines and growth factors [BR:lcf04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108872574
Glycosaminoglycan binding proteins [BR:lcf00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   108872574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 108872574
NCBI-ProteinID: XP_018515861
UniProt: A0A4W6EXZ4
Position
Unknown
AA seq 420 aa AA seqDB search
MWLPRLALLLLLRFSGVLLVEGLNTCQSINLDAQKSRRIEAVRGQILSKLRIRSPPDEDD
EATPPGSVPPEVILLYNSTRELLKERARLAESACERESSEEDYYAKEVQRIDMLPPRTDT
NAVQPAAPNPHYRVVHFDVSGVDLTNSTLVKAEFRIFRAPNPQARASEQRVEIYQLLKPD
EESTSTQRYIDSRTVQPKAKGSWISVDVTETIKDWVSDPENNLGLKLGVHCPCCTFVPST
NNIVPNKSEELEALFAGVDDEQLRQIRKPGQVKGQADFSTKTPHLILTLLPSDRVDNPAK
KNRKKRAAATDTTTCSRGSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYLW
SANNHYNMILPLYNKLNPEASASPCCVPQDLEPLTIMYFIGRTPRVEQLSNMVVKSCKCR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcccccgcctcgcgctgctgctgctgctccggttctccggtgtgttgctggtg
gaggggctcaacacgtgccagtccatcaacctggacgcgcagaagtcccggcgcatcgag
gcggtccgcgggcagatcctcagcaagctccgcatccgcagcccgccggacgaggacgac
gaggccacgccgcctggctccgtgcccccggaggtcatcctgctgtacaacagcacgcgg
gagctgctgaaggagcgcgcgcgtctggccgagtccgcctgcgagcgcgagagcagcgag
gaggattattacgccaaagaggtgcagaggattgacatgctgcccccccgcaccgacaca
aacgcggtgcagccagcagcacccaacccccactacagagtcgtccatttcgacgtcagc
ggagtcgacctgaccaacagcaccctggtcaaggccgagttcaggatcttcagggctccc
aacccgcaggcccgggcctcagagcagagagtggagatctatcagctgctgaagccagat
gaagagagcacctccactcaacgttacatcgactcccgcaccgttcagcccaaggcgaag
ggatcctggatctcagtggatgtcacagaaaccatcaaggactgggtgtctgatccagag
aataatctcggcctgaagctgggcgtccactgtccctgctgcaccttcgtcccgtccacc
aacaacatcgttcccaacaagagcgaggagctggaggccctgtttgcaggtgtggatgac
gagcagcttcgtcagataagaaagcccggtcaggttaaaggccaggcggatttcagcacc
aagacgccgcacctcatcctcaccctgctgcccagtgacagagtcgacaacccggccaag
aagaaccgcaagaagagggcggcagccacagacaccacaacctgctcccgcggctcggac
cagggctgctgcctgcgctcgctctacatcgacttcaggcgtgacctcaactggaagtgg
atccatgagcccaaaggttacaaagctaacttctgtgctggaaactgcccttacctctgg
agtgccaacaaccactacaacatgatcctgcccctgtacaacaagctgaaccctgaggcc
tccgcctcgccctgctgcgttcctcaggacctggagcccctcaccatcatgtacttcata
ggccgcacaccacgcgttgagcaactctccaacatggtcgtcaaatcctgcaagtgccgc
tga

DBGET integrated database retrieval system