KEGG   Lates calcarifer (barramundi perch): 108872984Help
Entry
108872984         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase kinase 4-like
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108872984
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108872984
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108872984
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: STE group
  STE20 family
   108872984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108872984
NCBI-ProteinID: XP_018516472
Position
Unknown
AA seq 1523 aa AA seqDB search
MANDSPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNQLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIESCLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEDPPEQEGEPSSIVNVPGESTLRRDFIRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQEEKRRIEEMDRRRKEEEERRRAEDEKRRNDREQEYIRRQLEEEQRHLE
MLQEQLLREQAMLLEFKWRELEEQRKAERLHKRLQQEQAYLLSLQHESKQQPGDKTKIPS
DHSKPPQTTSTLPPDRTLATAPQAQVLDSVVSVARGAHESSRAPQTTPSDGAKSQAAMPE
KTDAVETCPGQPTNSPSPSPAQTETPTDSKPPQAESSEPDRPAESVSHPPQPIREADERY
RKNIQGSPQTAPPPKQPPLPPRSSEPFSNGGSSSEASAMHRPMEPQVQWSHLAALKSSNS
AAPSPPPPPPPPVVSRSQSFSEPGGVNSSFAQLHLRSQDPHHHHHHHHHHPSPARTDPQP
QPPLHHHPQAQTRAEHQASSEEVPPKVPVRTTSRSPVLSRRESPLPSQPGNQGGQRNARQ
RPLWDRVEKLQPRPGSGSSSGSSNSSSQASPGDRFRPRCESPASSKSEGSPLQRPENVPK
KQDEKNLARPTRPAADVDLTALAKELRAVDDVRPIHKVTDYSSSSEESGTTDEDDDEEVD
QEAGEESTSGAEDSRAGRMSNGETESAKTMLVEDSESDQATTPSKDGTLVIRPSTVDIKR
LVNLSSSSSSSFSSPSAGSGLGHGQPQPPGHGLAEKNGFAGRIHHLPDLIQQSHHPPSST
TTIPCSSSSSTSSSSSSSFPSSSSHASPAMSPQIPLDKLTAIESQSESNSMSKHKSSSSF
TPFIDPRLLQISPSSGSSLNNMAGFGQDGRLVDPLRVDPSRKGSVVNVNPVNTRPPSDTP
EIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQGKVYPLINRRRIQQMDVLEGL
NVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWVNVGDLEGCVHYKVVKYERIKF
LVLALKNSVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDLTVEEGQRLKVIYGSCSGFHA
VDVDSGAVYDIYLPTHIQTSIQCHAIIILPNTDGIELLVCYEDEGVYVNTYGRITKDVVL
QWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFMHKRAQRLKFLCERNDKVFFA
SVRPGGASQVYFMTLGRTSLMSW
NT seq 4572 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccagctaaaagtctagtagacatagacttggcttcattgcgggat
ccagctgggatatttgaattggtggaggtagttggaaatggcacctatggacaagtatac
aagggacgacacgtcaagactggacagctggctgccatcaaggtcatggacgtcacagag
gatgaagaggaggaaattaaactggagatcaatatgttgaagaagtattcccaccacaga
aacatagccacctactatggtgctttcattaagaaaagccccccgggacacgatgaccag
ctatggctggtgatggagttctgtggagctggttccatcacagacctggtgaagaacacc
aaggggaaccagctgaaggaagactggatcgcctacatctccagagagatcctcagaggt
ctggcccatttacatgcccaccacgtcatccatcgtgacatcaagggccagaacgtcttg
ctgactgagaatgctgaagttaaactagtggactttggtgtgagtgctcagctggatcgg
acagtgggacggagaaacaccttcatcgggactccttattggatggctcctgaggttatc
gcttgtgacgagaacccagacgctacatacgattacagaagtgatctgtggtcttgtggt
atcacagctattgaaatggctgaaggagcgccacctctgtgtgacatgcaccctatgcgt
gcgctcttcctcattccaagaaaccctcctcctaggctcaaatccaaaaaatggtccaaa
aagtttttcagtttcatcgagagctgtctggtgaagaactacacgcagcgtcccccgacg
gagcagctgctgaagcaccccttcatccgcgaccagcccaacgagaggcaagtccgcata
cagctcaaagaccacatcgaccggaccaagaagaagaggggagagaaggatgagacagag
tatgagtacagtggcagcgaggaggaggaagaggatcccccagagcaggagggagaaccc
agctccattgtcaatgtgccaggtgagtctactctccgccgcgacttcatccgcctgcag
caggagaacaaggagcgctcagaggcgcttcgccgccagcagctcctccaggagcagcag
ctccgggagcaagaggagtacaagcgccaactactggccgagaggcagaaacgcattgag
cagcagaaggagcagaggaggcggctggaagagcaacagcgacgtgaacgggagatgagg
aggcaacaggagcgtgagcagcgtcgccgtgagcaagaggagaagaggcgtattgaagag
atggatcgtagacgtaaagaagaggaggaacgccggcgggccgaggacgagaagaggagg
aacgatcgcgaacaggagtacatccgacgtcagctggaggaggagcagagacacctggag
atgctgcaggagcagctgctccgtgaacaggccatgctgctggagttcaagtggcgggag
ctcgaggagcagcgcaaggccgagcgactccataagcgcctgcagcaggagcaggcctac
ctgctgtcgctccagcacgaatccaaacagcagcctggcgacaagaccaaaatcccctca
gaccatagcaaacccccacagaccacctccaccctgccccctgacagaaccctagcaaca
gccccgcaagctcaggtccttgacagcgtcgtttctgtagcgagaggagctcacgagtcc
tcccgagcccctcagaccaccccctctgacggcgctaaatcccaggcagcaatgccagaa
aagactgacgctgttgagacctgtcccggccagcccacaaactcccccagccccagcccc
gctcagactgaaaccccaactgactctaaacctccccaggcagagagttcggagcccgac
aggcccgccgagtctgtcagtcatcctcctcagcctatcagagaggccgacgagcggtat
cgcaagaatattcagggctcccctcagacagcccctcctcccaagcagccccctctgcct
ccccgctcctctgaaccgttctccaatggcggctcctcctccgaggcctccgccatgcac
cggcccatggagcctcaggtccagtggtcccacctggctgctctaaaaagcagcaacagc
gccgccccctctcctcctcctcctcctcctccgcccgtggtctctcgctcccagtccttc
agcgagcccggcggcgtgaactctagctttgcacaactccacctccgttcccaggacccc
caccatcaccaccaccaccaccaccaccacccatcgcccgcacgcactgacccccagccc
caacctcccctccaccaccaccctcaggcccagactagggccgagcaccaggccagcagc
gaggaggtgcctcccaaggtaccagtgaggacaacatccaggtctcctgtactgtcgcgc
cgagagtcccctctgccgtctcagcccggcaaccagggcggacagaggaacgccaggcag
cgcccgctgtgggaccgagtggagaagctgcagcctcggcccggcagcggcagctcctcc
ggctcctccaactccagctcccaggccagtcctggggaccgctttaggccacgctgtgag
tctcctgcttcctccaaatctgaaggatcgcctctccagcggcctgaaaatgttcccaaa
aaacaagatgaaaagaacctcgccaggcctactcgaccagctgctgacgtggacctgact
gctctggccaaggagctccgcgcagtagacgacgtgcggcccatccacaaggtcactgac
tactcctcctcaagcgaggagtccggcaccactgacgaggacgacgacgaggaggtggac
caggaggccggagaggagtccacttcgggagctgaggactccagagctgggaggatgagt
aacggggagacggagtccgctaagacaatgctggttgaagactcggagagcgaccaagcc
accacaccctccaaggacggcacgctggtcatcaggccgagcacggttgacataaagcgg
ttggtcaatctctcatcctcctcctcctcctccttctcctctccctcggctggctctggt
ctcggccacggccagccccagccccccggccacggcctcgcagagaaaaacggctttgcc
ggccgcatacaccacctgccagaccttatccagcagagccatcaccccccttcctccacc
acaaccatcccctgctcctcctcctcctccacctcgtcctcctcctcttcctccttcccc
tcgtcatctagccatgccagtcctgccatgtccccacagatccccctggacaagctcact
gccatagagtcccagtcagagagcaactccatgtccaaacacaagtcttcctcttccttc
actcccttcatcgacccacgccttctccagatctctccatccagcggcagctccctcaac
aacatggctggatttgggcaggacggacggctggtggatccgctgagggtcgacccgtcc
cgtaagggctcggtggtcaatgtcaacccggtcaacacgcgcccgccaagcgacacgcca
gagatccgcaagtacaagaagaggttcaactcggagatcctatgtgctgcactctggggg
gtaaacctgctggtggggacagagagcggtctgatgctgctggaccgaagcggtcagggt
aaggtctaccccctgatcaaccggcgacgcatccaacagatggatgtcctggagggactc
aatgtcctggtcaccatatcaggtaaaaagaacaagctgcgggtgtattacctgtcgtgg
ctccgaaacaagattttgcacaacgaccctgaggtggagaagaagcagggctgggtcaat
gtgggcgacctggagggttgcgtccactacaaagtcgtgaagtatgagaggattaagttc
ttggtgctggccttgaagaattctgtggaggtgtacgcctgggcacccaaaccctaccac
aaattcatggcctttaagtcttttggcgacctggtgcacaagcctctactggttgacctg
acggtggaggagggtcagaggttaaaggtcatctacggctcctgctcaggcttccatgct
gtggatgtggattccggtgccgtctacgacatctacctgcccacacatatccagaccagc
atccagtgtcacgccatcatcatcttacccaacaccgacgggatcgagctgctggtgtgt
tacgaggacgagggagtctacgtcaacacctacgggcgcatcactaaggacgtggtgctg
cagtggggagaaatgccaacttcagtggcctacattaggtcaaaccagatcatgggctgg
ggtgagaaggccatagagatccgctctgtggagacgggacacctggacggcgtcttcatg
cacaagagagcccagagactcaagttcctttgtgagaggaatgacaaggtcttctttgcc
tctgtgcgccccggaggagccagccaggtgtacttcatgaccctgggacgcacctccctc
atgagctggtag

DBGET integrated database retrieval system