KEGG   Lates calcarifer (barramundi perch): 108873786Help
Entry
108873786         CDS       T04895                                 

Gene name
tiparp
Definition
(RefSeq) TCDD-inducible poly [ADP-ribose] polymerase
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108873786 (tiparp)
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108873786 (tiparp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE zf_CCCH_4 Torus AraC_binding_2
Motif
Other DBs
NCBI-GeneID: 108873786
NCBI-ProteinID: XP_018517635
Position
Unknown
AA seq 724 aa AA seqDB search
MDKTLHILQKAPDGVPTGISLDMSLNMDEGEDFTEQQIMGLPDKIPLVKPYFKKKQRKLD
AKCLHRALEDPILTTLLSTDTLVSGDGVFVPRNQPGRTPGNLCAAAVVKQNCMGQVCLKA
DSGAADDATAGAGVPGLMTRDGDVELADTTAELEETERRGERPKITDPTPDSRCFQLKPA
LRAAGNTVTITPTGRDIPPIVAPQAPHQEGAIKSNDLLTSGAKNLPVKDCTGVQDPLPLL
LQPDKGVLFQDKSEEASLDLVFELLTQLQYHTHQSDSVDICVDFLQGQCVYGNDCAHHHT
VLPYHWQIHRTSSQTWQSIADDSQEQLERLYCNPDNEQVRLKFQGRMFSLDFGAMRVCDL
EFDRVRRLTTPPSPLPAPTTNPNPTPSCHTVWKYYCRDNFGWREYSEPVVKLIEEASSRG
LKEVRFITLQNQYILNIREGFQQNAIFGFRRQIKKRPMFMSSVMLTPHLQTLGGLSSSPL
PCSSSSSSSSSSSSSSMDLSTSHPLSPTTTNPPSLFPETWLPMTMSQDFLQVPVSREDRS
YRTVYSLFHKTVSETKFRIIKILRVQNPFLWEKYKRKKEYMSRRMSEMDRLLSERHLFHG
TSADVVEGICKHNFDPRVCGKHATMFGQGSYFARKAVYSHNFSKRSPKGVHCMFLAKVLT
GRFTVGNPSMRRPPPINPRDPSSDLYDSCVDNWVDPQIYVIFNDDQSYPYFIIHYEEVPS
TVAV
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggataaaactttgcacattcttcagaaagccccagacggtgtgccgactgggatctcc
ctggatatgagtttgaatatggacgaaggggaagatttcacggagcagcagatcatgggg
ctgccggacaaaatacctttggtgaaaccttatttcaaaaagaagcagaggaaattagac
gccaaatgcctccaccgcgccttggaggatcctatactgaccactttactaagcacggat
acgctggtctccggggatggggtgttcgttccccggaaccaaccgggtcggaccccggga
aacctgtgcgcagcagccgtggtgaaacagaactgtatgggccaggtgtgcctcaaagct
gactcgggagctgctgacgatgccacagccggggctggagtaccagggttgatgacccgg
gacggtgatgtggaattagccgatactactgcggagttggaggagacagagaggcgaggg
gagcgacccaagatcaccgaccctacccccgacagccgctgctttcagctgaaacctgcc
ctcagggcggccgggaacacagtaacaataacacccaccggcagggatatacctcccata
gttgcaccccaggctccgcaccaggagggggccatcaaaagcaatgacctcttaacctct
ggggctaaaaaccttccagtcaaagactgcactggagtccaggacccccttcccctcctc
ctgcagcctgacaaaggagtgctatttcaggataaaagtgaggaggcctccctggacttg
gtttttgagctgctcacccagctccagtatcacacacaccagtcagactcagtggacatt
tgtgtggatttcctccaaggacagtgtgtttatggcaacgactgtgcccaccaccacact
gtcctgccctaccactggcagatccacaggaccagtagtcagacgtggcagagcatagca
gacgactcccaggaacagctggagagactgtactgcaaccctgacaatgagcaagtcagg
cttaagtttcagggtcgcatgttttccctcgacttcggggcaatgcgagtgtgcgacctg
gagtttgaccgggtacgtcgactgaccactcccccgagccctctgcccgcacccacaacg
aacccaaatcccacccccagctgtcacacggtgtggaagtactactgcagagacaacttt
ggctggagggaatactctgagcctgtggtgaagctcatagaggaggcgagctcgaggggt
ctcaaggaggtgcggttcattacgctccagaaccagtacatcctcaacatcagggagggc
ttccagcagaacgccattttcgggttcagacgtcagatcaagaagcggcccatgttcatg
tcctctgtgatgcttacaccccacctacagacgttgggaggcctctcttcatctcccctc
ccctgttcctcctcctcttcctcatcctcctcctcctcctcctcgtccatggatctctcc
acctcgcatcccctctcgcctaccaccaccaacccgcccagcctttttccggaaacgtgg
ttgcccatgacgatgagccaggacttcctgcaggtgccggtctcgcgtgaagaccgcagc
taccgcacagtgtacagccttttccacaagacagtgtccgagaccaagttcaggatcatc
aagatcctgcgtgtgcagaaccccttcctctgggagaagtataagaggaagaaggagtac
atgtcacgacgcatgtcagagatggaccggctgctgagcgagcgccacctcttccatggc
acctcggctgacgtggtggagggcatctgcaagcacaacttcgacccacgagtctgcggc
aaacacgccaccatgtttggccagggctcctactttgcccgcaaggctgtctactcccac
aacttctccaagcgctcgcccaaaggagtccactgcatgttcctagccaaagtcctcact
ggcaggtttactgtaggaaatccctccatgcgaagacctccacccatcaaccctcgtgac
ccctccagtgacctttatgactcctgtgtggacaactgggtggacccccagatctacgtc
atcttcaacgatgaccagagctacccttactttatcattcactatgaagaggtacccagc
actgtcgctgtctaa

DBGET integrated database retrieval system