KEGG   Lates calcarifer (barramundi perch): 108875315Help
Entry
108875315         CDS       T04895                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00071  Fatty acid degradation
lcf01212  Fatty acid metabolism
lcf03320  PPAR signaling pathway
lcf04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108875315
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108875315
   03320 PPAR signaling pathway
    108875315
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lcf03029]
    108875315
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     108875315
Mitochondrial biogenesis [BR:lcf03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    108875315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 108875315
NCBI-ProteinID: XP_018519649
Position
Unknown
AA seq 785 aa AA seqDB search
MAEAHQAVGFQFTVRPDGVDFKLSQEVIKNIYLSGVTAWKKRAIQFKNGVLAGVYPASPS
SWLIVVIAMMSSLYIRIDPSLGMIDAIKDNLPQREHVSVQTRVVLSAILFATGLWLFLIY
LLRYTLKVLLSYHGWIFESHGKMSTSTKVWLSLVKMFSGRRPLLYSFQASLPRLPVPSVD
DTIHRYLESVRPLLDNDQYNQMEILANDFRDFKAAQLQRYLILKSWWATNYVSDWWEEYI
YLRGRSPIMVNSNFYIMDLLYMTPTHRQAARAGNVVHAMLQYRRKLERGEHAPLRALGTV
PMCSTQMERMFNTTRIPGIETDIVQHLTDRKHLVVYHKGRFFQVWLYTGGRHLLPSELET
QFQRILNDTSEPQPGELKLAALTAGNRVPWARARIKYFSQGVNKVSLDAIESAAFFLTLD
DEPQGYDPAKTNSLDSYAKSLLHGKCYNRWFDKSFTLISYPNGKIGINAEHSWADAPIVG
HMWEYVLATDCFHLGYTEEGHCKGDVNKGLPLPTRLQWQIPKECQEVIETSYLSAKQIAD
DVDFHGYLFTDFGKGLIKKCRTSPDAFIQLALQLAQFRDQGVFCLTYESSMTRMFRDGRT
ETVRSCTSEAVAFVRAMEDADATNAQRLALFRKAADKHQNMYRLAMTGSGIDRHLFCLYI
VSKYLGVDSPFLKKVLSEPWKLSTSQTPQQQLNLVDINKFPKYVGAGGGFGPVADDGYGV
SYIIVGENLITFHISCKFSCPNTDSYRFGQNIQKAMLDIQGLFKPENDEKVVERRKHIEN
GKKHI
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcacatcaggcggtgggcttccagttcactgtgcgccctgatggtgtggac
tttaaactcagtcaagaggtcatcaaaaacatctacctgtcaggagtgacagcatggaag
aagagagccatacagttcaagaatggtgtattagctggagtctatccagccagtccatcc
agctggctgatagttgtgattgccatgatgagttcgttgtatatccgcatagacccctct
ctaggaatgattgatgccatcaaggataacctaccacaaagagaacatgtgtcagtgcag
acccgagtggtgctgagtgccatcctctttgctactggactgtggctgttcctcatctac
cttttgagatacactctcaaagttctgctctcctaccatggctggattttcgaatcccac
ggaaaaatgagcacatctaccaaagtgtggctgagcctggtgaagatgttctctggacgc
agaccactgctttacagtttccaggcctctttacccaggctccctgtgcccagtgtggat
gatacaatccacaggtaccttgagtcagttcgtcctctgctggacaatgaccagtacaac
caaatggagattttggccaatgactttagagatttcaaagcagcccagctgcagagatac
ttaatcctaaaatcctggtgggcaacgaattatgtaagtgactggtgggaggagtatatc
tacctcaggggcaggagtcctatcatggtaaacagtaacttctatataatggacctcttg
tatatgaccccaacacaccgacaggctgcacgagcagggaacgtggtccatgccatgctg
cagtacagacgcaaactggaacgtggtgaacatgcaccgctgagggctttggggaccgtt
cctatgtgttccactcagatggagagaatgtttaacaccacccgcatccctggcattgaa
acagatattgtgcagcatctgactgaccgtaagcacctggttgtctaccacaagggccgc
ttcttccaagtatggttatacactggagggcgccacctcttacccagtgaacttgagaca
cagtttcaaaggattcttaatgatacatcagaacctcagccaggagaactcaaattagct
gccctgacagcaggaaacagagttccctgggctcgggctcggattaaatatttcagtcag
ggagtgaacaaagtgtccctggatgccattgagtcagctgccttcttcctgacactggat
gacgagccgcaaggttatgaccctgcaaagactaattcactcgatagttatgctaagtcc
ctgctgcatggaaaatgttacaacaggtggtttgacaagtctttcaccctgatctcgtat
ccaaatggaaaaattggtataaatgctgaacattcttgggctgatgcaccaattgtagga
catatgtgggagtatgtccttgcaacagactgcttccatcttggctacacagaggaagga
cactgtaaaggggatgtgaacaagggccttcctcttcccactcgactacagtggcagatt
ccaaaggagtgtcaagaagtcatcgagacctcatacctatcagccaagcagatagctgat
gatgtggactttcatggttacctgtttactgattttgggaaaggcctgatcaagaagtgc
cggaccagccctgacgcctttattcagctggccctgcagttggcgcagttcagggatcag
ggagtgttttgtctgacgtacgagtcatcaatgacccgtatgttcagagacggtcggaca
gaaacagtacgctcctgcacctctgaggcagttgcatttgtcagagccatggaggatgca
gatgcaacaaatgcccagagacttgccctgtttcggaaggcagcagataagcatcaaaac
atgtatcgtctggccatgactggttctggtattgaccgtcacctcttctgtctctacata
gtgtccaagtaccttggtgttgactcaccatttcttaagaaggtgctgtcagagccctgg
aagttgtctaccagccagaccccacagcagcagctcaatttagttgacatcaataagttc
cctaaatatgttggtgctggtggtggatttggcccagtggctgatgatggttatggtgtg
tcttatatcattgttggggaaaacctcatcacattccacatctcctgcaagttctcttgc
cccaacacagactcataccggtttggtcagaacattcagaaggccatgcttgacatccaa
ggacttttcaagcctgaaaatgatgagaaagtggtggagcgtagaaagcacatagaaaat
gggaaaaagcacatataa

DBGET integrated database retrieval system