KEGG   Lates calcarifer (barramundi perch): 108875506Help
Entry
108875506         CDS       T04895                                 

Gene name
mgst2
Definition
(RefSeq) LOW QUALITY PROTEIN: microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00480  Glutathione metabolism
lcf00980  Metabolism of xenobiotics by cytochrome P450
lcf00982  Drug metabolism - cytochrome P450
lcf00983  Drug metabolism - other enzymes
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108875506 (mgst2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108875506 (mgst2)
   00982 Drug metabolism - cytochrome P450
    108875506 (mgst2)
   00983 Drug metabolism - other enzymes
    108875506 (mgst2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lcf02000]
    108875506 (mgst2)
Enzymes [BR:lcf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108875506 (mgst2)
Transporters [BR:lcf02000]
 Other transporters
  Pores ion channels [TC:1]
   108875506 (mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 108875506
NCBI-ProteinID: XP_018520011
Position
Unknown
AA seq 140 aa AA seqDB search
MGTDSPFLLAAVSLLSVLQMGYLARQVGLSRMVHKVLPPSVTGPPEFERTFRAHQNCVEC
YPLFLVTLWTCGMFFSEVTAATGGLLYIIIXQIYFNGYVKSAKKRLPGFYLTLAVFFTLS
LLALIGILRGLLHKYFHTHL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgactcccctttcttgttggctgcggtgtctcttctgtctgtcttgcaaatg
ggctacctggcccggcaggttggattgtccaggatggtccataaggtcctaccaccctct
gttactggtcctccagagtttgagaggactttccgtgcacatcagaactgtgtggagtgt
taccctcttttcctggtgacactgtggacctgtggtatgttctttagtgaagtgactgca
gctacaggaggactgctgtacataatcatctgacaaatctattttaatggatatgtcaag
tctgccaagaaaaggttacctggtttctacctgaccctggctgtctttttcactctgtct
ctactggctttaattggaatactgcgtggactacttcacaagtactttcatacccatctc
tga

DBGET integrated database retrieval system