KEGG   Lates calcarifer (barramundi perch): 108875870Help
Entry
108875870         CDS       T04895                                 

Gene name
acox1
Definition
(RefSeq) peroxisomal acyl-coenzyme A oxidase 1 isoform X1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00071  Fatty acid degradation
lcf00592  alpha-Linolenic acid metabolism
lcf01040  Biosynthesis of unsaturated fatty acids
lcf01100  Metabolic pathways
lcf01212  Fatty acid metabolism
lcf03320  PPAR signaling pathway
lcf04146  Peroxisome
Module
lcf_M00087  beta-Oxidation
lcf_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    108875870 (acox1)
   00592 alpha-Linolenic acid metabolism
    108875870 (acox1)
   01040 Biosynthesis of unsaturated fatty acids
    108875870 (acox1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    108875870 (acox1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    108875870 (acox1)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     108875870 (acox1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ACOX Acyl-CoA_ox_N Acyl-CoA_dh_M Acyl-CoA_dh_1
Motif
Other DBs
NCBI-GeneID: 108875870
NCBI-ProteinID: XP_018520558
Position
Unknown
AA seq 661 aa AA seqDB search
MNPDIIKERQNATFDVEKLTNILDGGPEKTKRRREIEALVLSDPDFKEEDPNFLSRSERY
DQAVRKSAQMILKLREYGIADPEEIYCYKTSVHPDRPEPLDLHLGMFLPTLLNQSTPEQM
DRFFMPAWNLEIIGTYAQTEMGHGTHLRGLETTATYDPATQEFVLNSPTVSSIKWWPGGL
GKTSNHAIVLAQLYTQGNCHGLHAFIVPIRDMSTHEPLPGIVVGDIGPKFGFNEVDNGFL
KLENVRIPRENMLMKYAKVEPDGTYVKPPSAKLTYGTMVFIRSIIVGESARALAKSCTIA
IRYSAVRHQSEIRPGEPEPQILDYQTQQYKLFPLLAMAYAFTFVGQYMKQTYHRISGDIN
QGDFSELPELHALSAGLKAFTTWATNAAIEVCRMSCGGHGYSRSSALPDIYVEFTPTCTY
EGENTVMMLQTARYLVKSYRQAKDGQQLSGIVSYLNEAEHRRVQPQPVAARPTVVDINDL
ASLVEVYKLRAAILVELAAKSIQQELQRRKSQEDAWNNSAIDLVRASDAHCHYVVVKLFT
DKLGEIGDTAVHSVLSTLALLYALHGITQNSGDFLQAGLLSVPQVLLISVRIKELLAQLR
PNAVVLVDAFDFHDKKLNSVLGRYDGNVYENLFDWARRSPLNSTEVHDSFHKYLKPLRSK
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccgatattataaaagagcggcaaaacgccacttttgacgtcgagaaactcacc
aacattttggacgggggcccagagaagaccaaaagaagacgagaaattgaggcactggtt
ctcagcgatccggactttaaggaggaggacccaaacttcctgtcccgcagtgagcgctat
gaccaggctgttcgaaaaagtgcccaaatgatcctgaagctcagagagtatggcattgca
gacccagaggagatctactgttataagacctccgtgcaccccgacaggccagagcccttg
gatctacatctggggatgttcctgcccacactgctcaaccagtccaccccagagcaaatg
gaccgtttcttcatgcccgcctggaacctagagatcatcggcacctacgctcagactgag
atgggccacggcacacacctcagagggctggagaccacagccacgtacgatccagccaca
caggagtttgtcctcaacagtcccacagtcagctccatcaaatggtggcctgggggactt
ggaaagacctcaaaccatgccatagtcctagcccagctttatactcagggaaattgccac
ggtctgcacgctttcattgtgcccatccgtgacatgagcacacatgaacccctgccaggc
attgtggtcggagatattggccctaagtttggcttcaatgaagttgacaatggcttcctg
aaactagagaacgtacgaatcccacgggagaacatgctgatgaaatacgccaaggtggag
ccagatggaacctatgtgaagccaccaagtgccaagctgacctacggcaccatggtgttc
atccgctccataattgtaggcgagtcagctcgcgccctcgcaaagtcctgcactatcgcc
atccgctacagtgccgttcgccatcagtctgaaatccggccgggagagccagagccccag
atcctcgactaccagacgcagcagtataagctgttccctctgctggctatggcctatgcc
ttcacttttgttggccagtacatgaagcagacctaccaccgcatctccggagacatcaac
cagggagacttcagtgaactgcctgagctccacgctctgtctgcgggtctgaaagccttc
accacatgggcaaccaacgccgctatcgaggtctgccgcatgtcgtgtggtggccatggc
tactctcgcagcagtgccttgcctgacatttacgtcgagttcacccctacctgcacctac
gagggagagaacacagtcatgatgctgcagactgcacgatacctggtaaagagctaccgt
caggctaaggacggtcagcagctgagcggcattgtgtcgtacctgaatgaagcagagcat
cgcagggtgcagccccagcccgtcgctgccagaccaacggtggtcgacattaatgacctg
gctagcctggtggaggtctacaaactacgagctgccatcctagtagagctggcagctaag
agcatccagcaagagttgcagcgcaggaagagccaggaggacgcctggaacaacagtgct
atcgacctagtcagagcctcagatgcccactgtcactatgtcgttgtcaaactcttcact
gacaagctgggtgagataggtgacacagcagtacactcagtgttgtcaaccctggctctc
ctctacgccctgcatggcatcacacagaactctggggacttcctacaggctggactgctg
agcgtgccccaggtgttgctgatttctgttcgtatcaaggagctgctggctcagctgcgg
cccaacgccgtggtgctggtagatgcctttgacttccatgacaagaagctgaattcggtc
ctgggacgatatgacggaaacgtctacgagaacctgtttgattgggctcgccgctcaccc
ctgaactccacagaggtccatgattccttccacaagtacttgaagcccctgcggtccaaa
ctgtga

DBGET integrated database retrieval system