KEGG   Lates calcarifer (barramundi perch): 108876546Help
Entry
108876546         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: activin receptor type-1B-like
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04060  Cytokine-cytokine receptor interaction
lcf04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108876546
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108876546
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108876546
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     108876546
Protein kinases [BR:lcf01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   108876546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Pkinase_fungal APH FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 108876546
NCBI-ProteinID: XP_018521661
Position
Unknown
AA seq 499 aa AA seqDB search
MALKQIAPTLLALLGLVAVGNALRCNCTNCEKTGYECETDGACMASTYYIQGKEQHVRIC
INRDNLVPPGQPFYCLSAEGLLNTHCCYVDYCNSIDLKVPVPTKGGDWSSQGSPWGPVEL
VAVIAGPVFLLCVLLMVGVFLFQYHQRAYSHRQRLEVEDPSCDHLYLAKDKTLQDLIYDM
STSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGKWRGGDVAVKIFSSREERSWFR
EAEIYQTIMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYSVTIEGMIK
LALSAASGLAHLHMEILGTQGKPGIAHRDLKSKNILVKKNGMCAIADLGLAVRHESITDT
IDIAPNQRVGTKRYMAPEVLDETINMKHFDSFKCADIYALGLVYWEIARRCNAGGIHEEY
QLPYYDLVPSDPSIEEMRKVVCDQKLRPNVPNWWQSYESLRVMGKIMRECWYANGAARLT
ALRIKKTLSQLSVEEDVKM
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaaacaaattgcccctacgctgctggccctgctcgggttagtggccgtcggt
aatgctctgcgttgtaactgcacaaactgtgagaagacaggatatgagtgtgagacagat
ggcgcctgcatggcctcaacgtactatatccaggggaaggagcaacacgtacgcatctgt
atcaaccgggacaacctggttccccctggacagcccttctactgtctgagtgctgaaggc
ctgctcaacacacattgctgctatgtagattactgcaacagtattgacctgaaagtccca
gtcccaacaaaagggggggactggtcaagccaaggaagtccctgggggccggtggagctg
gtggcggtcatcgcagggccggtgttcctgctatgtgtgctgctgatggtcggcgtgttc
cttttccagtatcaccagagggcctacagccacaggcaaaggctggaggtagaggacccc
tcctgtgaccatctgtacttggccaaggacaagaccctgcaggacctcatctatgacatg
tccacctctggatcaggctctggtttgcccctgtttgtgcagcggacagtggccaggacc
atcgtgctgcaggagataataggaaagggtcgtttcggcgaagtgtggcgagggaagtgg
agaggaggagatgtggcggtgaagatcttctcatccagggaggagcgctcctggttcaga
gaggcagagatctaccagacaatcatgctgcgacacgagaacatcctaggattcatcgca
gcagacaataaagacaatggcacatggactcagctctggctggtgtcagactatcatgag
cacggctctctttttgactacctgaaccgctactctgtcaccatcgagggcatgatcaaa
cttgcactgtcagcagccagcggcttggcgcacctccacatggagatcctcggcactcag
ggtaagcctggcattgctcaccgtgacctcaagtctaaaaatatcctggttaagaagaac
ggcatgtgtgctatagccgacctgggtctggcagtccgccatgagtccatcacagacaca
atcgatatagcaccgaaccagcgtgtgggcactaagagatatatggctccagaagttctg
gatgaaaccatcaacatgaaacactttgattcctttaagtgtgctgacatttacgcgctg
ggcctggtgtactgggagattgcgcgtcgctgtaatgcaggaggtatccatgaggagtac
cagctgccctactatgacctcgtgccctctgacccctccatagaggagatgaggaaggtg
gtgtgtgaccagaaactgaggcccaatgtgcccaactggtggcagagctatgagtcgctg
cgcgttatggggaagatcatgagggagtgctggtacgccaacggtgcagccagactgaca
gccctgcgcatcaagaagactctgtctcagctcagcgtggaggaggacgtcaaaatgtga

DBGET integrated database retrieval system