KEGG   Lates calcarifer (barramundi perch): 108876819Help
Entry
108876819         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tankyrase-2-like
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lcf03032]
    108876819
   03036 Chromosome and associated proteins [BR:lcf03036]
    108876819
Enzymes [BR:lcf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108876819
DNA replication proteins [BR:lcf03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     108876819
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     108876819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank Ank_2 Ank_5 Ank_4 Ank_3 PARP SAM_2 SAM_1 CART
Motif
Other DBs
NCBI-GeneID: 108876819
NCBI-ProteinID: XP_018522092
Position
Unknown
AA seq 1228 aa AA seqDB search
MASVAAGFWGSAACCSHSKLSRTGSLKLGRGRSPPSMSSGRRCSGVSGLGGGAVSPGPMV
AEVVEPGGGTGAGEASRELFEACRSGNLERVRKLVTAENVNSRDTAGRKSTPLHFAAGFG
RKDVVDFLLQNGANVHARDDGGLISLHNACSFGHAEVVSLLLHHGADANARDNWNYTPLH
EAAIKGKIDVCIVLLQHGAEPTIRNTDGRTALDLAELSTKAVLTGEYRKDELLESARSGN
EEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVKTVQLLLQHGADVHAKDKGDLVPLH
NACSYGHYEVTELLVKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTFLNCH
NKSSIDLAPTSQLKERLAYEFRGHSLLQAARDADVVRVKKHLSLETISFKHPHTQETALH
CASASPYTKRKQVCELLLRKGANVNEKMKDLLTPLHLASEKAHNDIIEVLVKHEAKVNTV
DHLGQTALHRAARCGHLQTCRLLLSAGSDPLLTSLQGFSPSQLGNKSVQEILQEGVLVGN
SEVDRQLLEASKTGDLETVQKLCTVQNVNCRDVEGRQSTPLHFAAGYNRLAVVQFLLQHG
ADVHAKDKGGLVPLHNACSYGHYEVAELLVLHGAVVNVADLWKFTPLHEAAAKGKYDICK
LLLQHGADPTRKNRDGNTPLDLVKDADTDIQDLLRGDAALLDAAKKGCLARVKKLCTHDN
VNCRDTQGRHSTPLHLAAGYNNLEVAEYLLQHGAEVNSQDKGGLIPLHNAASYGHVDVAA
LLIKYDACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTHRNQEGQSPLDLVTADD
VRALLTAAMPPSALPGCYKPQVISVVASASGSPPIAVVPPLLSSSSSSSSCPAPTLLLLP
SSSSSSSSGLDASTAATTKMSEGSLDAEKKEEVPGVELSICQFLKNLGLEHLLETFDREQ
ITLDVLVEMGHRELKEIGINAYGHRHKIIKGVERLISGPQSLNPYLTLNTANSGTILIDL
AADDKEFQSVEEEMQSTIREHRDGGHAGGVFNRYNLVKIQKVCNKKLWERYTHRRKEVSE
ENHNHSNERMLFHGSPFVNAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGG
TGCPTHKDRSCYICHRHLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAE
YVIYRGEQAYPEYLITYQIMKPESPADG
NT seq 3687 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagtggctgcagggttctggggttcagccgcttgctgctcgcactctaaactc
tccagaaccggcagtctgaaactaggacgaggccgttctccgccgtccatgtcgtccggc
cggagatgttcgggggtgtccggtcttgggggcggagccgtgtccccggggcccatggtg
gcggaggtggtggagcccggcggtgggacgggggctggcgaggccagcagggagctgttt
gaggcctgtcggagcggaaacctggagcgagttcgcaaactggtgacggccgagaacgtg
aacagccgggatacagcggggaggaagtccacaccgctgcactttgctgcaggttttgga
cgtaaagacgtggtggacttcctcctccagaacggagccaatgtccacgccagggatgac
ggagggctgatatccctccacaacgcctgctccttcggccacgctgaggtggtgagtttg
ttgcttcaccacggggcagatgcaaacgccagagacaactggaactacactccacttcat
gaagcagccatcaagggcaagatcgacgtgtgtatagtgttgctgcagcacggggccgag
ccgaccatcaggaacacagacggtcgcactgctctggatctggcagaactgtccaccaaa
gcagttctgacaggtgaatacaggaaagatgagcttctggaaagtgccaggagcgggaac
gaggagaagctgatggctctgctgacgccgctcaacgtcaactgtcacgccagtgatgga
cgaaagtcgacgccgttacatctggcagctggctacaaccgggtcaagactgtccaactg
ttgctgcaacacggtgctgatgtgcacgccaaagacaagggggacctggttcctcttcat
aatgcctgttcatatggtcactacgaggtcactgagctgctggtcaagcatggagcctgt
gttaatgccatggacctgtggcagttcactccccttcatgaagctgcctctaagaaccga
gttgaggtgtgttctctcctgctgagctacggagccgaccccaccttcctgaactgtcac
aataaaagctccatcgacctcgctcctacctcgcagctgaaggagcgactcgcctatgag
ttcagaggtcacagcctgctgcaggcagccagggacgccgatgtggttcgggtcaagaaa
catctgagtctggagaccatcagcttcaaacacccgcacactcaggagactgcactgcat
tgtgcgtctgcctctccgtacacaaagaggaaacaagtgtgtgaacttctactgaggaaa
ggagccaacgtcaacgagaagatgaaggacctgctcactcctctccacctggcgtcggag
aaagcccacaatgacatcattgaggtgttggtcaaacatgaagccaaggtgaacacggtg
gatcacctgggtcagacggcgctgcaccgagccgctcgctgcggacacctgcagacctgc
aggctgctgctgagcgccggcagcgacccgctgctcacatcgctgcaggggttctctccc
tcacagctgggaaacaagagcgtgcaggagatactgcaagaaggtgtactggtcgggaac
tctgaagtcgaccgacagctgctggaagcctccaaaacaggagatctggaaactgtccag
aagctctgcacggtgcagaacgtgaactgcagggacgtggagggtcgacagtcaacaccg
ctgcatttcgccgccggctacaaccgtctggccgtcgtgcagttcctgctgcagcacgga
gccgacgtacacgccaaggacaaagggggtctggttcccctccataacgcctgctcctac
ggtcactatgaggtcgcagagctgttggtccttcacggagctgtggtcaacgtggccgac
ctctggaagttcaccccgctgcatgaagctgctgccaagggcaaatatgacatctgtaaa
cttctgctgcagcacggtgctgacccgacccggaagaaccgggacggtaacacccctctg
gatctggtgaaggacgccgacacggacattcaggacctgctgcggggtgacgctgccctg
ctggacgctgccaagaaaggctgcctggcccgggtgaaaaaactctgcacacacgacaac
gtcaactgcagagacacacaggggagacactccacgccgctacacctcgctgcgggctac
aataacctggaggtggcagagtacctgctgcagcacggggcagaggtcaactctcaggat
aaaggaggactgattcctctgcacaacgcggcttcctatgggcacgtggatgtggcagct
cttctcatcaagtacgacgcctgcgtcaacgccaccgataagtgggcgttcacgccgcta
cacgaggccgcccagaagggccgcacgcagctctgtgcgctcctgttggctcacggtgcc
gaccccacccaccgaaaccaggaggggcagtcacctctggacctggtcacggctgatgat
gtccgggccttgctaacagcagcgatgcctccctctgctctccctggttgttacaaacca
caggtcatcagtgtggtggcgtcggcctctgggtcgccacccattgccgttgtcccacca
cttctctcctcttcctcctcctcctcttcctgccctgcccctactctcctcctcctcccc
tcttcctcctcttcctcctcttctggtcttgacgcctcaacagcagctacaactaaaatg
agtgagggatcactggacgctgagaagaaagaggaggttccaggagtggagctcagtatc
tgtcagttcttgaagaacctgggtttggagcatcttctggagaccttcgacagagaacag
atcactctggatgtgctggtggagatgggtcaccgtgagctgaaggagatcggcatcaac
gcctacggacacagacacaagatcatcaaaggagtggagaggctcatcagcgggccgcag
agcctgaacccttacctcacgttgaacacagccaatagtgggacgatcttgatcgacctc
gctgccgatgacaaggagttccagtcagtggaggaggagatgcagagcacgatcagagag
caccgagacggcggccacgctggaggagtcttcaacagatacaacctggtcaagatccag
aaggtctgcaacaagaagctgtgggagaggtacacgcaccgcaggaaggaggtgtcagag
gaaaaccacaaccactccaacgaacgcatgctcttccacggttctccgttcgtcaatgcc
atcatccataaaggttttgacgagcgccacgcctacatcggcgggatgtttggcgctggg
atttactttgctgagaactcgtcgaagagtaaccagtacgtgtacgggatcggaggaggg
acgggctgtccgacgcacaaagaccgctcctgctacatctgccacaggcacctgttgttc
tgcagggtgactctgggtaaatccttcctacagttcagtgccatgaagatggctcactca
ccgccaggtcaccactcagtcaccggtaggccgagtgttaatggcctcgctctggccgag
tacgtcatctacagaggagagcaggcctatccagagtacctgatcacctaccagataatg
aagcctgaatctcctgcagatggatga

DBGET integrated database retrieval system