KEGG   Lates calcarifer (barramundi perch): 108877018Help
Entry
108877018         CDS       T04895                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like isoform X1
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00232  Caffeine metabolism
lcf00983  Drug metabolism - other enzymes
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    108877018
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    108877018
Enzymes [BR:lcf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     108877018
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 108877018
NCBI-ProteinID: XP_018522441
Position
Unknown
AA seq 349 aa AA seqDB search
MKIIQNVCVNVNAPSSGDTRALTTASHYLPRGRRRNVLPSQLNFNNSTELQVTSQSEGEM
NLEEYFKRIGFHGSYEKLDLETLKLIHKQHIMSIPFENLSIHCGERIVMDLEVIFNKIVR
SGRGGWCLENNFLFGWVLREMGYNTTTLGSKVFNSILNVFGPLESHLINKVVIDGKAYIA
DVSFGVSSQVREPLELISGKDQPQAAGVFRLIENEDIWVLEKTGRKPEVVNPEFAKSSLV
NRKETKQIYCFTLVPREADHFFDKSHTLQTDPSSLFTNKSICSLQTPTGFRALIGWTYSE
VTYKPEEGVDVLDMRDIPDEEIEQILMEKFNIKLQNKLKPVSNKAWYTL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattcaaaatgtgtgtgtaaatgttaacgctccctctagcggcgatactcga
gccctaacaactgcaagtcactatttacctcgaggacggcgacgtaatgttttaccatca
cagttaaacttcaacaacagcacagagctacaggttacgtcacagtctgaaggcgagatg
aatttggaggagtacttcaaaagaattggtttccatggctcatatgagaaactggatctt
gaaacactgaagctgatccacaaacagcacatcatgtccattccttttgaaaacctcagt
attcactgtggtgagaggatcgtcatggacctggaggtaattttcaataagatagtgagg
agtggacgtggaggctggtgccttgagaacaactttctgtttggctgggtgctgagagag
atgggctacaacactacgactttgggctccaaagtttttaacagtatcctcaatgttttt
ggtcctcttgaatctcatctcatcaacaaggttgtcattgatggaaaagcttacatagca
gatgtaagctttggggtgtcctcccaagtgcgggagcccctggagctcatctctggaaag
gaccaacctcaggcagcgggggtctttcgtctcatagaaaacgaagacatctgggtgctg
gagaaaactggtagaaagccagaggttgtcaatccagagtttgccaaatcaagtctggta
aacaggaaggaaacaaagcagatctactgcttcaccctggtgcctcgagaggctgatcat
ttctttgataaaagccacacacttcagacagatcccagttcactgttcactaataagtct
atctgctctttgcaaacacccacaggattcagagccctgattggctggacctacagtgag
gtcacctacaaaccagaggaaggtgttgatgtcttagatatgagggacataccagatgag
gagatagagcaaattctgatggaaaaattcaatataaagctgcagaacaagctaaagcct
gtaagcaacaaagcatggtacacactctaa

DBGET integrated database retrieval system