KEGG   Lates calcarifer (barramundi perch): 108878162Help
Entry
108878162         CDS       T04895                                 

Gene name
plk2
Definition
(RefSeq) serine/threonine-protein kinase PLK2
  KO
K08861  polo-like kinase 2 [EC:2.7.11.21]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    108878162 (plk2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108878162 (plk2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lcf03036]
    108878162 (plk2)
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     108878162 (plk2)
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   108878162 (plk2)
Chromosome and associated proteins [BR:lcf03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    108878162 (plk2)
   Centrosome duplication proteins
    Regulators of centriole replication
     108878162 (plk2)
  Sister chromatid separation proteins
   Polo kinases
    108878162 (plk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr POLO_box Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 108878162
NCBI-ProteinID: XP_018524078
Position
Unknown
AA seq 657 aa AA seqDB search
MEVQRNSAPQQTNSSSMCESTQRSCEPRRKRMDERSAPSEMARIITDPVTGKCYCRGKVL
GKGGFAKCYEMTDLSTSKVYAAKIIPHARVSKPHQREKIDREIELHRALHHRHIVHFYHH
FEDKENIYILLEYCSRKSLAHILKARKVLTEPEVRYYLRQIVSGLKYLHEQEILHRDLKL
GNFFVSESMELKVGDFGLAAKLEPAGNRRKTICGTPNYLSPEVLNKQGHGCESDIWALGC
VMYTMLLGRPPFETTNLKETYRCIREARYSLPSSLSPQAKQLIANLLAKIPEDRPNLDHI
LRHDFFTQGFSPERLPASCCHSAPDFHVSSPAKSFFKKAAAALFGGKRDKVKYYETLNKL
TKEEEEIYKLQHDLERTVISQQQSKKISENGSLLPPSAESPVALATEGQSPTMRDTIRLI
VRGSLGSCSSSSECLEDNTTGSVAETVASVLRGCLENMPKADDIPQSANSCSLQWVTKWV
DYSNKYGFGYQLSDHTVGVLFNNGTHMSLLPDRKTIHYYAELGQCSVFPTCEVPEHFVGQ
VTVLKYFSHYMEENLMDGGDLGSMTDAHMPRLYLLQWLKSDRALMMLFNDGTFQVNFYHD
HTKIILCCQRDEYMLTYINEDRVSKTFKLSSLLTSGCPTDLRERMVYSLNMLLQRCS
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacagagaaatagcgcgccccaacagacaaacagcagcagtatgtgcgaatcg
acgcagaggtcctgcgaacctcgccgaaagagaatggatgagcgcagcgcgccctcggag
atggccaggataatcaccgatcctgtcacggggaagtgctactgccgtggaaaagttttg
ggaaagggagggttcgcgaaatgctacgagatgaccgacctctccaccagcaaagtttac
gcagccaaaatcatcccacatgcgcgcgtctccaaacctcatcaacgggagaagattgac
agagaaattgagctgcacagagctctgcaccatagacatatagtgcacttttatcaccat
tttgaggacaaggagaacatctacatcctgttggaatactgcagtagaaaatcattagct
catatccttaaggctcgtaaggtgcttactgagccagaggtgcgttattatctaaggcag
attgtctctgggctaaagtacctgcatgagcaagaaatccttcacagagacctgaaactt
ggtaacttctttgtgagtgagtcgatggagctgaaggtcggggactttggtctggctgcc
aagttggagccagcaggaaacaggaggaagacgatctgtgggactcccaactacctgtcc
cctgaggtgctcaacaagcagggccatggttgtgaatcagacatctgggcccttggctgt
gtaatgtacaccatgctgttgggcagaccaccatttgaaaccaccaacctgaaggagaca
tacaggtgtattagagaggcacggtactccctgccctcgtccctgtcacctcaggctaag
cagttaatcgccaaccttctggccaagatccccgaggacaggcccaacctggaccacatt
ctgaggcatgacttcttcacgcagggcttcagtccagagcgtctgccggctagctgttgc
cattcagcaccagatttccacgtttctagtcccgccaagagcttcttcaagaaagctgcc
gctgcgctctttggtgggaagagagacaaggtcaaatactacgagactctgaataagtta
accaaagaggaagaggagatctacaaactgcagcacgaccttgagagaactgtcatcagc
caacaacagagcaaaaagatttcagagaatggaagtctacttccaccatctgccgagagc
cccgttgccctggcaacagagggccagtccccgacgatgcgagataccatccgtctgatc
gtcagggggagtctggggagctgcagcagcagtagcgaatgtctggaagacaacacaaca
gggagcgtggctgaaactgttgcaagtgtgttgaggggttgtctggagaatatgcctaaa
gcggatgacattcctcagagcgcaaacagctgcagtcttcaatgggtgactaaatgggtg
gactactccaacaagtatggctttggctaccaattgtctgatcacaccgtgggagttctc
ttcaacaacggcacccacatgagcctcttgccagacagaaagaccatccattactatgca
gagttgggccagtgctctgtcttccccacctgtgaggttcctgaacattttgttggccaa
gtgactgtgctcaagtacttttcccactacatggaggagaacctcatggatggtggggac
cttggtagtatgacggatgcacacatgcccagactctacctgctgcagtggctcaagtcc
gaccgcgccctcatgatgctctttaatgacggcactttccaggtcaacttttaccatgac
cacaccaagatcattctgtgttgccagagggatgagtacatgctgacgtacattaatgag
gaccgtgtctccaaaaccttcaaactcagctccctgctgacgtcaggctgccccactgac
ctgcgtgaacgcatggtgtactccctcaacatgcttctgcagagatgcagctaa

DBGET integrated database retrieval system