KEGG   Lates calcarifer (barramundi perch): 108878613
Entry
108878613         CDS       T04895                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
lcf  Lates calcarifer (barramundi perch)
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lcf01002]
    108878613 (adamts13)
Enzymes [BR:lcf01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     108878613 (adamts13)
Peptidases and inhibitors [BR:lcf01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   108878613 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN TSP1_spondin Reprolysin_4 Reprolysin_3 Reprolysin_5 Reprolysin_2 ADAM_spacer1 CUB Peptidase_M10
Other DBs
NCBI-GeneID: 108878613
NCBI-ProteinID: XP_018525002
UniProt: A0A4W6FMQ8
Position
Unknown
AA seq 1395 aa
MVFMTLLCLLLLQPGLSALMRSPLDELFHHSSNQRDIVSSPDSSPDASESRRLRRSAIIP
DVTHLELLVVVGPDVQQIHKQDTERYILTNLNIASELLRDMTLGANMRVHLVRMIILSEP
EPEIQMSTNITSSLRSVCDWGRRINPTNDTDPLHADLLLYITRYDLVLPDGNKQVRGVTQ
LGGACSSEWSCVITEDTGFDLGITIAHEIGHSFGINHDGVGNTCSRSGFMMASDGGYNSV
DLTWSPCSRQQLFTFFSEGKAECVNDLPVMEGSLQDWKPGLYYGVDDQCRIAFGSTARAC
TFTNPDLPACRVLSCHINPGDDSSCKRLLVPLLDGTECAPNQWCLKGRCVSPVELSSSVV
VHGSWSSWSEFTTCSRTCGGGVTHRTRQCNNPRPAFGGNDCQGPDIEAELCHQQPCEHTQ
LDFMAEQCSQTNLHPLYLLPNTASFYTWIPAVGFIQGDEQCRYMCQSDGDNFIVSRGSQF
VDGTRCESDSPPPFGSTAACLRGKCQLFGCDGVLQSGKVRDVCGVCGGDGSSCSLTSDSY
TGGQAREYTTFLSLPVNATQVHIVNRAPLFTHMAVTVGDKYIVSGGGSMALNMTHPSPLD
DNCLEYHLHLTPDLLPAMEELLLPGPLQQEINIQVYRKYGKEYGEKTNPNISYQFYVPTR
GNLTGNTPKGKWVVFTTPCSVTCGSGVQKHVYVCSDEVTNSHLEEHSCETPPPPVPLQTT
CQLSPCPPRWDVGTFGPCSASCGGGEMVRPVRCVQKHGADVVKVPDSECPANTAPNAVEK
CNLQHCPARWHVSEPGECSAVCGPGEAKRVVSCVRPEVGQDVEVDQSFCSKQIKPPDSVP
CVVDVCPIGWDSKGKDQPMLKVGLLPRSRQAPVYVWSPVISQCSKTCGNGTLQVWFSCVD
HQTRLGVPDFHCDALTKPSPHSEICSTSPCPPMWRSKQGVCSVTCGGGVANRVLYCAREA
EREEVVVEDSECSDSLKPTAVVSCNTQSCPARWKVFRTSPCSVSCDLGVAQRIVSCVHFV
HGKERVVPDENCHTAVKPATTVPCLVQVCTFRWEVKPWSQCSVPCGYGIQSRTVSCLGPS
KSEPLSPLLCMHMPKPITIQGCYMGSCGDMPPTLDVVSDATTATQTVKMVNLTEGPLLSP
TLSHTDTPQHRMGRLPPLPTETITIPQTTMTTTPAPKGACGQLFLEESGTVDLKDVTSHC
TVSIGRPLDEVIHIRVESSSLNCRKKEYVAFYDRLAFLRKCAQIAGSELTSRTNVLLVRQ
NLLTPGNGIVFTYKSQKNTKRGHHQDCDIQLFSPSGDFENPATSSTNHTCRVLINAPPGV
KIRIQALHIGLVFNATNSQSTYIMIRDMDVLKTNVFKGQQLFLWHSSGNMAEIEFHGDYL
HTKGSFRAEYSFTSP
NT seq 4188 nt   +upstreamnt  +downstreamnt
atggtttttatgactctgctctgtctgctgctgctgcagcctggcctcagcgctctaatg
agatctccattggacgagctatttcatcactcctccaatcaaagagatatagtctcctct
cctgattcttctcctgatgcctctgagagtaggcggctgcgtcggtcagccataatacct
gatgtcacccatctggagctgctggtggtggtaggacctgatgtgcagcagattcacaag
caggatacagaaagatacatcctcaccaacctcaatattgcctcagagctgttgagagac
atgaccctgggcgccaatatgcgggtgcacctggtccgcatgatcatcctgtcagagcca
gagccagagattcaaatgtctaccaacatcacctcatctcttagaagtgtgtgtgactgg
ggcagacggataaaccccaccaatgatacagacccactacacgctgatctattgttgtac
attacaaggtatgacctggtgttgcctgatgggaataagcaggtcaggggagtaacgcag
ctgggtggggcttgctccagtgaatggagctgtgtgatcacagaggacacaggctttgac
ctgggcatcaccatcgctcatgaaattggtcacagttttggaatcaaccatgatggagtg
ggaaacacctgcagcaggagtgggttcatgatggcctctgatggaggctacaacagtgta
gatctgacctggtccccctgcagcagacagcagctgttcacattcttcagtgaagggaag
gctgaatgtgtaaatgacctgcctgtgatggaaggttccctacaagactggaagcctggt
ctgtactatggagttgatgaccagtgtcgtatagcttttggtagcactgcaagagcctgc
actttcaccaaccctgaccttccagcttgtcgtgttctgtcctgtcatattaaccctggt
gacgacagctcctgcaaacgtctcctagttccactgctggatgggacagagtgtgcacca
aatcagtggtgtctgaaggggcgctgtgtgtccccagttgagctcagctcctctgtggtg
gtacacggctcctggtccagctggtctgagttcaccacctgttctcggacgtgtggtggg
ggagtcactcaccgcactcggcaatgcaacaaccctagacctgcttttggagggaacgac
tgtcagggtccagatattgaggctgaactttgtcaccagcagccttgtgagcacacccag
ttagatttcatggcagagcagtgttcccagaccaacctccatcccctctacctgctacca
aacacagcctctttctacacatggatccctgctgtaggttttatacaaggggatgagcaa
tgcagatatatgtgccaatcagatggagacaacttcatagtgagtcgtggctctcagttt
gtggatgggactcgctgtgagtcagacagtccgcctcccttcggctctacagctgcttgc
ctaagggggaaatgccagctgtttggctgtgatggtgtgctacagtctggaaaagtgagg
gatgtgtgtggggtgtgtggtggagatggatcatcctgcagtttgacctctgactcctac
actggtggtcaggccagagagtacaccaccttcctctctctgccagtgaatgccacacag
gttcatattgtaaacagggctcctctcttcactcacatggctgtaacagttggggataag
tacattgtgtctggaggcggcagcatggcactgaatatgacccacccctccccactggat
gataactgcctggaatatcaccttcacctgacccctgaccttttgccagcgatggaggag
ctgctgctgcctggaccgttgcaacaggagataaacatacaggtctatcgcaaatatgga
aaagagtatggggagaaaacaaacccaaacattagttaccagttttatgtacctaccaga
ggtaacttgacaggcaatacacctaaaggcaaatgggtcgtctttacgacaccctgctct
gtcacctgtggatcaggtgtacagaagcatgtatatgtctgttcagatgaagttactaac
agccatttggaggaacacagctgtgaaacacctccaccacctgtaccactccaaacaacc
tgtcagctctcaccctgtcctcccaggtgggatgtagggacatttgggccatgtagtgcc
tcctgtggtggaggagagatggtgcgtcctgtaagatgtgttcagaaacatggtgcggat
gtggtgaaggttccagattctgagtgcccagccaacacagctccaaacgctgtcgaaaaa
tgtaacctgcaacactgtccagccaggtggcatgtgtcagagccaggggaatgttcagca
gtgtgtgggccaggagaagccaaacgtgttgtgtcatgtgtccgtccagaagttggtcag
gatgttgaagtggatcaaagcttttgttcaaagcagatcaaaccacctgattctgttccc
tgtgtggtagatgtttgtcctattggttgggactcaaagggaaaggaccagcccatgcta
aaggttggtttgttgccacgctctagacaagctcctgtgtatgtgtggagccctgttatc
agccagtgctccaagacctgcggcaatggaaccctgcaggtgtggttttcctgtgtggac
caccagaccagacttggggtgcctgacttccactgtgatgctttgaccaaaccttctcct
cactctgagatctgcagcacatctccctgccctcccatgtggcgctctaagcaaggagtc
tgcagtgtaacatgtggaggaggggtggccaacagagtgctgtattgcgctcgagaagca
gagagggaggaggtggttgtggaggattcggagtgtagtgactctcttaaacccacagca
gtggtttcatgtaacacccaaagctgcccagcaaggtggaaggtattcaggacgtcaccc
tgctctgtgtcctgtgacttgggtgttgctcagaggattgtgtcttgtgttcattttgtc
cacggcaaggagcgtgtggtgccagacgaaaactgccacacagctgtcaaaccggccacc
acggtcccctgcctggtgcaagtctgcaccttcaggtgggaggtgaagccatggagccag
tgttcagtgccctgtggatatgggatccaatccagaactgtgtcctgtctgggcccctct
aagtctgagcccctcagccctctgctttgcatgcacatgcccaagcccatcaccatccag
ggctgttacatgggcagctgcggagatatgccgcccacattagatgttgtctccgacgcc
accactgcaacacagactgtcaagatggttaacctcacagagggacctcttctgtctccc
actctgagccacacagatacaccacagcaccgcatgggtcgtcttcctccacttccaaca
gagacaatcacaatcccacagaccaccatgacaaccaccccagcccctaaaggtgcatgt
ggacagctattccttgaggaatcaggcacagtggatttgaaagacgtaaccagccactgc
acggtgtccataggccgacccctagatgaagtcattcacattagagtggaatctagctcc
ttgaattgcaggaaaaaggagtatgtggcattttatgaccgacttgcatttttgaggaag
tgtgcgcagatagcagggagtgaactgacctctagaaccaatgtcctgctggttcgtcaa
aatctgctcactcctgggaatgggattgtgttcacctacaagtcacagaaaaacactaag
agaggccaccatcaggactgtgacattcagctgttctcccccagcggtgactttgagaat
ccagcaacgtccagcactaaccacacctgtcgagtgctcatcaatgcccctcccggagtg
aagatcagaatccaagcgcttcacataggattagtattcaacgccaccaactcccagtct
acatacattatgatccgggacatggacgtcttaaagacaaatgtctttaaaggccaacag
ctgtttctgtggcactcctctggaaatatggctgagattgaatttcatggagactacctg
cataccaaaggaagcttcagagctgaatattcctttaccagtccttga

DBGET integrated database retrieval system