KEGG   Lates calcarifer (barramundi perch): 108878990Help
Entry
108878990         CDS       T04895                                 

Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4-like isoform X1
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108878990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 108878990
NCBI-ProteinID: XP_018525606
UniProt: A0A4W6FUH4
Position
Unknown
AA seq 1283 aa AA seqDB search
MSRENTTRSLDSIDLAALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMEVTE
EEEEEIKLEINMLKSYSHHRNIATYYGAFIKKGPAGQDHQLWLVMEYCGAGSVTDLVKKT
KGNCLKEDWIAYICREVLRGLSHLHSHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDK
TIGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSLGITALEMAEGAPPLCDMHPMR
ALFLIPRNPPPKLKSKKWSKRFLSFVDNCLVKNHLHRPTTDALLRHAFIRDLANERQVRI
MLKDHLDRTRKKREKEGPEYEYSGSEEEEDEVAEEEGEPSSIVNVPGEWTLRREFLRLQT
EDRNGGREGGHGGGGGQQRQQALQQHRQQLAEQERYKQQLAADRQKRIQQQHEQRQKLED
QQRRQLTDCAFQWAELQEVLLGEESDLHDNRILLDERNRRSDRRQDQAGRKRSTDVSVRP
LDSAAEQRAVAPNRQLQNKAQHSQPQLQPQAKPQALAQHQQPSAGRRSHRTLPKDQTQLL
SLQHDHRHRERERERERQRQREKPVAAVQKLTANIGNTATAAAAAAAASSPSRPANSQRT
AMDFQESNLARLLLAAGLPNQMHSRLGSGSSSSPCTPAMQRAHLNQNANLRSSRDAPHSS
SLSDMAISPLSPFSPMSPTDDVFWDSVDAPPKVPERTTSKFYCRELVMGHKRAASSGSPV
SVADKSGRSVSHGVSSPSSNHPGYFKLESPLLHHRLQQQKKTQDNITSGYTQGVKSPLGR
FNKATEYSSSSDEVGSSDDEDRNRSGLSNGKRKYIRGIPDGIILQPHHNLNQIPRMGSDD
TYLLPDLLQKTSSSSPTHNALGQQQQTHELSYSQSPTAPRCPSHQELHMSMAVSSPTGKN
TSTSSSSSFLSFIDPRLIPISSPPQSPTGSKGDPIKRENHRKGSVVNVNPTNIRPQSDTP
EIRKYKKKFNTEVLCAGLWGVNLLVGTENGLWLLDRSGQGKVYSLISRRRFQQMDVLEGL
NVLITISGKKNKLRLYYLSWLRNKILHNDPEVEKRQGWTSVGDLEGCVHYKVVRYEKIKF
LVIALKNAVEVYAWAPKPYHKFMAFKSFRSLPQRPLSVDLTVEEGQRLKVIYGSLSGFHA
IDVDSGTPYDLYLPTHIQGSIRPHAIIILPNSAGTEVLVCYEDEGVYIDTYGRITKDTVL
QWGEMPASVAYLQSNQVMGWGEKAIELRSANTGNLEGVFMHKKAQKLKFLCERNDKVFFA
SVQSGGSSQIYFMTLGQNSLFSW
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagagaaaacaccacccgaagtctggacagtatagacctcgctgctttaagagat
ccagcaggtatctttgagttggttgaggtggttggcaatggaacctacggtcaagtgtac
aagggtcgtcatgtcaagacaggccagctggcagctattaaagtcatggaagtcacagag
gaggaagaagaggagataaagttggagatcaacatgttgaagagttattcccaccacaga
aacatcgctacatattatggagcttttattaagaaaggtcctgctggacaggaccaccag
ctctggttggtgatggagtactgtggagccggctcagtaacagacttggtgaagaaaacc
aaaggaaactgtctgaaggaagactggatagcttacatctgccgagaggtgctcaggggt
ctttcccatcttcactcccatcatgtgattcacagagacatcaagggacaaaatgttttg
ctcacagagaatgctgaagtcaaactggttgactttggagtgtcggctcagctggacaag
accattggtcgtaggaacaccttcattggtactccctattggatggctccagaggtcatc
gcatgtgatgagaaccctgatgccacatatgactacaggagtgacctctggtctttaggc
atcaccgctctagagatggctgaaggagcccctcccctgtgtgacatgcatccaatgaga
gcactgtttttaattccacgaaaccctccacccaaacttaaatcaaagaaatggtcgaag
cgtttcctgtcgtttgtcgataattgtttggtgaagaaccacctacatcgacccaccacc
gacgcccttctgagacacgctttcatcagagacctggctaatgagagacaagttcgcatc
atgctcaaagatcacctggacaggaccaggaagaagagagagaaagagggtccagagtat
gagtacagtggcagtgaagaggaggaggacgaggtagcagaggaggaaggggaacccagc
tccatagtgaatgttcctggcgaatggacgttgagacgagagtttcttcgcttacagaca
gaagatcgtaacggaggcagagagggaggccacggaggaggtgggggacagcagagacag
caggcattacagcagcacaggcagcagttggcagagcaggaacgatacaagcagcagtta
gcggctgacagacagaagaggatccaacagcaacatgagcaacggcaaaagttagaggat
cagcagaggcggcagctgacagactgtgcctttcagtgggcagagcttcaagaggttttg
cttggggaggagtctgatctccatgacaacagaatcttactggatgagagaaacaggagg
agcgacaggagacaggaccaggcaggcagaaagcggagcaccgatgtgtcagtaaggcct
ctggactccgcagcagagcagagagctgtggctccaaaccggcagcttcagaataaggcc
cagcactcccagcctcagctccagccacaagccaagccccaggctctggcccagcatcag
cagccctcagcaggcaggagatcccaccgcaccctgcccaaggaccaaacgcagctcctg
tcgctgcagcacgaccacagacacagggagagagagagggaaagagagaggcagaggcag
agagaaaagcctgtggcagctgtccagaagctaacagctaatattgggaacacagctact
gctgctgctgctgctgctgctgcttcctcgcccagccgccctgcaaacagccagcgcaca
gcgatggacttccaggaatcaaacttagccaggctgcttttggcagctggtcttcccaac
cagatgcactcgaggctgggatccgggagcagctctagtccctgtaccccagccatgcag
agagctcacctcaaccagaatgccaatctgcgctctagtcgagacgcccctcacagcagc
tctttgtcagatatggccatttcccccttgtctccattttcccccatgtccccaactgat
gatgtcttctgggattcagtcgatgcaccacctaaagtccctgaacgcactacctctaag
ttttactgtagagagctggtgatgggacacaagagggccgcttcaagtggcagtccagtg
tctgtagcagataaaagtggaagatctgtgtctcatggagtctcgtctcccagcagcaac
cacccaggttacttcaagctcgagagtcctcttctacaccaccgtctccagcagcaaaaa
aagacacaagataacataaccagcgggtatactcagggtgtcaaatctcctcttggacgg
tttaacaaagccacagaatactcctcctccagtgatgaagttggtagcagtgatgacgaa
gacaggaatcggtctggcctgtccaatggaaaaaggaaatacatcagaggaatacctgat
ggcatcatcctgcagcctcaccacaatcttaaccagatacctcggatgggttctgatgat
acctatctgctgccagaccttctgcagaaaacctcttcttccagtcctactcataatgca
ctgggccaacagcagcaaacacatgaactcagctactcgcagtcacccacagcccctcgg
tgtccctcacatcaggaattacacatgagcatggctgtcagcagccccactggtaagaac
acctccacatcttcctcttcctccttcctgtccttcatcgatccgagattgatccccata
tcatcaccgccacaaagtcctacaggcagtaaaggggacccaatcaagagagagaaccac
aggaagggctctgtggtgaatgtgaacccaaccaacattcggccacagagcgacactcca
gagatccgcaagtacaagaagaaattcaacacagaggttctctgtgctggactgtggggt
gtgaatctgttggtggggacagagaatggtctgtggctgctggaccgaagtggtcaaggg
aaagtctactctctcatcagcagacgaaggtttcagcagatggatgtgctggaagggctc
aacgtgctcatcactatatcaggtaaaaagaacaaactccgcctgtactacctgtcctgg
ttaaggaataaaatcctccacaatgacccagaggtggagaagaggcagggttggacctca
gtaggtgacctggagggctgtgtacactataaagtggtgcgttacgagaagataaaattc
ttagtgattgctttgaagaacgctgtggaggtgtacgcctgggccccaaaaccctaccac
aaattcatggccttcaagtccttcaggtctctgcctcaaagaccactgtctgttgacctg
acagtggaggaaggtcaaaggttgaaagtcatctacggctccttgtctggtttccacgcc
atcgatgtggactctggaacaccatatgacctctatctacctacacatatccaaggttcc
atccgtccccatgccatcatcattttgccaaacagcgctggaacagaggttctggtttgc
tacgaagatgagggcgtctacatcgacacctacggccgcatcaccaaggatacagtgctg
cagtggggggagatgcctgcatcagtcgcctaccttcagtctaaccaggtgatgggttgg
ggagaaaaggccattgaactgaggtctgccaacacaggaaacctggagggagttttcatg
cacaaaaaggcccagaaactcaagtttctttgtgaaaggaatgacaaggtgtttttcgcc
tcagtgcagtcaggaggcagcagtcagatttatttcatgactcttggacagaactcactg
ttcagctggtaa

DBGET integrated database retrieval system