KEGG   Lates calcarifer (barramundi perch): 108879280Help
Entry
108879280         CDS       T04895                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 2-like isoform X1
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf04140  Autophagy - animal
lcf04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    108879280
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    108879280
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108879280
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108879280
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: Other
  CAMKK family
   108879280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 108879280
NCBI-ProteinID: XP_018526027
Position
Unknown
AA seq 596 aa AA seqDB search
MFPCHVTPWPSAEPPASCGSHAPPAQPSQPLPDLLCSCPAPPLNTHSETPSPDPMESLIV
VTEYEPSRPPGEAGEGEEVEEMDSSETPEPASSVVAPFPTTSCDLLSHTVCRSEALLPES
QEQRGRLNLSDRKLSLQERSQSATSPCSSPGLNGRYIYPSLPYSPITSPHSSPRLPRRPT
VESHSVSITDLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLMRQA
GFPRRPPPRGAKAVPEGPPQPKGPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYM
VFELVKQGAVMEVPTDKPFSEDQARFYFQDLLRGIEYLHYQRIIHRDIKPSNLLVGEDGH
IKIADFGVSNQFEGADALLTSTVGTPAFLAPEALSETRKNFSGKALDVWAMGVTLYCFVF
GVCPFMDERILSLHQKIKTQPVVLPDHADISDDLKDLLLKMLDKNPETRISVAQIKVHPW
VTRHGAEPLPPEDDNCCMLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNPFDWGR
KEDRSSLCAPGPTLRKGRAGNVRYCYIHCNQRRKQESGDGMRSMDLPYVGEDEALS
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtttccttgtcacgtaaccccctggccctctgctgagccaccggcttcctgcggcagt
catgcacccccagcgcagccctcacaaccccttcctgacctgctgtgcagctgtcccgct
ccacctttgaacacccactctgagacaccctccccagaccccatggagtccctcatcgtg
gtcacggagtacgaacccagcagaccacctggagaggctggggagggggaggaggtagaa
gaaatggacagttcagagacgccagagccagcttcttctgtggtggcacctttcccaact
acatcctgcgacctgctgtcccacacagtttgccggtcagaggctctgctacccgaaagc
caagagcaaaggggaagattaaacctgtcggacaggaaactatctctgcaggagcgctca
cagagtgcaacatcaccctgcagctctccgggactcaacggacgctatatttacccatcg
ttaccctactcacccatcacatcaccgcactcttctccacgtttgccccgccggcccact
gtggagtcccacagtgtttccatcacagacctccaggactgtgttcaactcaaccagtac
aagctgaaagatgaaattggaaagggttcctatggtgttgtcaagctggcttacaatgag
gatgacaacacatactatgcgatgaaggtgttgtccaagaagaggctgatgaggcaggca
ggtttcccacggagacctccccctcgtggagccaaagcagttcctgaaggtccccctcag
cccaaaggacccctggaacgggtctatcaagagattgccatcctgaaaaagctggaccat
cccaatgtagtaaaactagtggaggttttggatgaccccagtgaggaccatctgtacatg
gtgtttgagctggtcaagcaaggagctgtgatggaggtgcccacagataaacctttcagt
gaggaccaggcacgcttttacttccaggatctgctcaggggaattgagtacttacattac
cagaggatcatccacagagatatcaaaccttctaacctgctagtgggagaagatgggcac
atcaagatagcagactttggagtcagtaaccagtttgagggagctgatgctctcctgaca
agcacagtgggaacacctgctttccttgctcctgaagcactctctgagactagaaagaac
ttctctggaaaggctttggatgtttgggctatgggagtgacgctttattgcttcgtcttt
ggagtgtgtccatttatggatgagcgcatcctcagtcttcatcagaaaatcaagacacaa
cctgtggtgttacctgatcatgctgacatatcagatgatctcaaagatttgttactgaaa
atgttggacaagaatccagagaccaggatatcagttgcacagattaaggtgcacccatgg
gtgaccaggcacggtgccgagcctctccctccagaggatgacaactgttgtatgctgatc
gaagtgaccgaggaggaggtggagaattctgtcaaacacatccccagtctggctacagtg
atcctggtgagaaccatgctgaggaagcgttcctttgggaacccctttgattggggtcgt
aaagaagaccgcagcagtttgtgtgctccagggccaacgctcaggaaaggcagagcaggc
aatgtgagatactgctacatacattgtaaccaaagaaggaaacaggagagtggtgatggc
atgaggagtatggacctgccctacgtgggagaagacgaggctctttcctga

DBGET integrated database retrieval system