KEGG   Lates calcarifer (barramundi perch): 108881061Help
Entry
108881061         CDS       T04895                                 

Definition
(RefSeq) sphingosine kinase 1-like
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00600  Sphingolipid metabolism
lcf01100  Metabolic pathways
lcf04020  Calcium signaling pathway
lcf04370  VEGF signaling pathway
lcf04371  Apelin signaling pathway
Module
lcf_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    108881061
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    108881061
   04371 Apelin signaling pathway
    108881061
   04020 Calcium signaling pathway
    108881061
Enzymes [BR:lcf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     108881061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 108881061
NCBI-ProteinID: XP_018528350
Position
Unknown
AA seq 565 aa AA seqDB search
MEKGASEPDPSRQRNGLVGALYGEFTDTLNDRVRYSVSLTESALTIQRISSSPGRTKVVF
NLTDCIGCRAYRGPDSADVGAYFTAYFYPFKRRWMSAGVARQRVEQCFRVALVQDPLANL
QEAEKWAHAIRDASVLQAPRRDGVAYTEVRRPCRVMILVNPHSGRGQALQLFTGHVQGML
TEASVPYTLVITEHQNHARELVRKADLSQWDALVIMSGDGLLFEVINGLMDREDWQEAIQ
TPLGILPGGSGNALAASVHHYSQSPPAWNEELLLSCGFILCKGLVGSLDLVSIHLASQQR
LFSFLSLAWGFVADVDIESEKYRHVGAIRFLMGTLVRLASLRVYQGRLAYLPVMEAPKLP
KGSIKATHPPSTPQHPSLCSSLPCRLIPNSSPNQNSRHNHNSTNSNHNTITNSSNNAITT
KRPETQSDGKTIALVDSLLPGLDQPVPESWTVVKEEDFVLVLAIYQSHLAEDLWTVPGAM
ADDGLIHLFYVTAGISRPALLRLFLAMEKGAHLACGCPHLVYEKVKALRLEPTSPQGVIT
VDGEMVEYGPVQAQIHPGLARLICG
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaggcgcctcagaaccggacccatcccgccagcggaacgggctagtgggcgcg
ctgtacggggagttcaccgacacgctcaacgacagggtccggtactcggtgagcttgacg
gagagcgccttgaccatccagaggatctcctcgtcacccggccggactaaggtggttttt
aacttgaccgactgtatcggctgccgggcgtacagagggccggacagcgcggacgtcgga
gcctacttcacagcctatttctacccgttcaagaggcgctggatgagcgccggggtggcc
cggcagagagtggagcagtgctttcgggtcgcgctggtccaggacccgctcgccaaccta
caggaggctgagaagtgggctcatgccatcagagatgcctcagtgctgcaggcgccccgg
agagacggtgtggcatatacggaggtgcgtcgtccttgccgtgtcatgatactggtgaac
cctcacagtgggcgtggccaggctctgcagctctttactggccacgtacagggcatgctc
actgaggcctctgttccctacacacttgtcatcacagagcaccagaaccacgcgcgcgag
ctggtgaggaaggctgacctgtcgcagtgggacgccctggttatcatgtctggtgatggg
ctgctgtttgaggtgataaatggtttgatggatcgagaggactggcaagaggccatacag
acccctctgggtattctgccaggtggctcaggcaacgccctggccgcctccgtccaccac
tactcacagtcacctccagcatggaacgaggagctactcttaagctgtggcttcatcctg
tgtaaaggtctggttggctccttggacctcgtgtcgatccacctggcctctcaacagcgt
ctcttctcctttctctccctggcctggggcttcgtggcagatgttgacatcgagagcgag
aagtaccgccatgtcggagcaatccgtttcctgatgggcaccctggtccgtctggcctcc
ctcagagtctatcagggcaggttagcatatttgcctgttatggaggcgccaaaacttccg
aaagggagcatcaaggctacccaccctccctccacacctcagcacccctcgctctgctcc
tcccttccttgtcggctcatccccaactcctctccgaatcagaactctcgacacaatcac
aacagcacaaattccaaccacaacaccatcaccaactcctccaacaacgccatcaccacc
aagagacctgagacccagagtgatggcaagaccatagcactggtggactctcttcttcct
ggcctggaccaaccagtcccagagagctggacagtagtcaaggaggaggactttgtcttg
gtcctggctatttaccagtcccacctcgctgaggacctgtggacggtccctggtgcaatg
gcagatgatgggctgattcatctgttctacgtgacagcaggaatctcccgtcctgccctc
ctgcgccttttcctcgccatggagaagggcgcccacttggcgtgcggctgcccccacctg
gtgtatgagaaggtgaaggccctgcggctggaacccacctctccgcaaggtgttatcact
gtggatggagagatggtggagtacgggcccgttcaggctcaaatccacccaggactggca
agacttatatgtggatga

DBGET integrated database retrieval system