KEGG   Lates calcarifer (barramundi perch): 108882212Help
Entry
108882212         CDS       T04895                                 

Definition
(RefSeq) guanylyl cyclase GC-E-like
  KO
K12321  guanylate cyclase 2D/E [EC:4.6.1.2]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00230  Purine metabolism
lcf01100  Metabolic pathways
lcf04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108882212
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    108882212
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lcf01001]
    108882212
Enzymes [BR:lcf01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     108882212
Protein kinases [BR:lcf01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   108882212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Kinase-like
Motif
Other DBs
NCBI-GeneID: 108882212
NCBI-ProteinID: XP_018530093
Position
Unknown
AA seq 1057 aa AA seqDB search
MQILQLLLLLCLWFLCVTDVWSATFKLALIGPWSCDPMFSRAMPTAAANLALSRLRSDGS
LSRGYWYDVKLLDEDCSVSKALTELGEMEGYGHAYIGPFNPALCHAASLLTQHWEAGLAS
PGCLDSDWANLPPITPPSRVLFTVLRFFRWAHVGIISAPSNLWESTGQEVASVLRSLGLP
IGPVVTMETKNNGGAREALRTIKDGDKVKVVIMCMSSVLIGGEDQRELLLAALEMGMVSD
GYIFIPYDALLYAMPYQDAVFPQLTNSTQLRHAYSSVLTVTMASDQSFYEAFRQAQMSRE
IRSAVSAMEVSPVFGTIFNMVYFVAKAVEERRQAGGGHWVTGNRLVQSDGGFDFQGFNQV
LYGGREGRGLQARYVVLNSDGDRLVPTHSLAPTHTDGTVGGLRPLSRSFIFPGGKPPTDS
FCWFSPEETCSGGVDTVTVFFIFLLLCSLIGAFSYWIRKYKRAANVTKLILTLDDIVFID
TQVSRKKLNDESIMRSLLEIKTPFRSIARSYILTTPESSNIGILEGDWVWLKKIPVGKTM
TAVNPNTQSLFSQLREMRHENLNLYLGLFLDSGIFALVVEHCPRGSLSDLLSDSNMRLDW
MFKSSLLMDLIKGMKYLHLRGLSHGRLKSTNCLVDGRFVLKITDYGLPMILHSQSLSLPD
DPQELLWTAPELLRNPVRGGSFAGDVFSFSIIIQEVISRTLPYAMMDMPAHEIVERLKQP
PPLCRPVVSVDEAPAECLSLMNECWNEDPSKRPSFDDVFKQFRGINRGKRANIIDSMLRM
LEQYSSNLEDLIRERTDELEVERNKTEKLVGQLLPKSVAQALKKGKPVQPEHYSDSTLYF
SDIVGFTTISALSEPIEVVDLLNDLYTMFDAIIASHDVYKVETIGDAYMVASGVPNRNGT
RHAAEVANMSLDILHSIGAFKIKHMPEIKVKIRIGLHSGPVVAGVVGLTMPRYCLFGDTV
TTASHMEATGLPYRIHISLSTVKVLTSLKLGYHFDTRKAQVKGSEDTYWLISRDGFSKPL
PVPPDLTGGASNHGISLDEIPVERRQKFLDRQKKTKK
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcctccagttgctgctgttgctctgtctgtggttcttatgtgtgacagatgtt
tggtctgcgaccttcaaactggctctgattggtccgtggtcatgtgaccccatgttctcc
cgggcgatgccaacggcagcagccaacctggcgttgtcacggttacggagcgacggcagt
ctgagcagaggatattggtacgatgtgaaactcctggacgaggactgctccgtctccaaa
gctctgacagaacttggggagatggagggttatggccacgcctacatcggaccctttaac
cccgccctctgtcacgccgcctccttactgactcagcactgggaggcgggactcgcctct
ccgggctgtctggactctgattgggcgaacctgccgcccatcactcctcccagcagagtc
ctgttcaccgtgctcaggttcttccgctgggcgcatgtcggcatcatctcagctccgtcc
aacctatgggagagcactggacaggaagtggcctcggtgctgcggtctttgggcctgccg
attggtccggtggttaccatggaaacaaaaaacaatggtggagctcgggaggcactgaga
acgatcaaagacggcgataaggtcaaagtcgtcatcatgtgtatgagctccgttctgatt
ggtggagaggatcagagagagctcctattggctgctctggagatggggatggtttctgat
ggttacatctttataccgtacgatgccctgctgtacgccatgccgtatcaggacgcagtg
tttcctcagctgaccaacagcacgcagcttcgtcacgcctacagctccgtcctgaccgtt
accatggcgtccgaccagagtttctacgaagcttttcgtcaggctcagatgagccgagag
atccggtctgcggtctccgccatggaggtgtctccagtctttggcaccatttttaacatg
gtgtacttcgttgctaaggcagtggaggagcgtcgtcaggcagggggcgggcactgggtg
acggggaaccggctcgtccaatcagatggaggctttgatttccagggattcaatcaggtg
ttgtacggaggtagagaggggcgtggccttcaggccaggtacgtggtgttgaacagtgat
ggtgaccgactcgtcccgactcactcgctcgctccgacgcacacggacgggacggtcgga
ggtctgaggccgctgagccgctccttcatcttccccggaggaaaaccccccacagacagc
ttctgttggttcagtccagaggagacctgcagcgggggtgtcgacacagtcaccgtgttc
ttcatcttcctcctgctctgctctctgattggagcattttcctactggatcaggaagtac
aaaagagcagcaaacgtcaccaaactgatcctgactctggacgacatcgtcttcattgac
actcaagtcagcaggaagaaactgaacgacgagtcgatcatgaggagtctcctggaaatt
aaaactccgtttcgctcgatcgctcgaagttacatcctgacgacacctgaaagctccaac
ataggaatactggagggcgactgggtttggctgaagaagattcctgttggaaagacgatg
acggccgtgaatccaaacacccagagtctgttcagccagctgcgggagatgagacatgaa
aacctgaacctgtacctgggtctgttcctggactctgggatctttgctctggtggttgaa
cactgtcctcgaggaagtctgtccgaccttctgtccgacagcaacatgaggctggactgg
atgttcaagtcctccttactcatggacctcatcaaggggatgaagtatcttcatctacga
ggtttgagtcacggtcgactgaagtcgacaaactgtttagtcgacggacgttttgttttg
aaaatcactgactatggccttcccatgatccttcactctcagagcctcagtcttcctgac
gacccacaagagctgctgtggacggctccagagctcttgaggaatccggttcgtggaggt
tcgtttgctggagacgttttcagtttctccatcatcatacaggaagtgatctcacggacg
ctgccgtacgccatgatggacatgccggcacacgagatcgtggagcgtctgaagcagccc
cctcctctctgcagaccggttgtgtcggtggacgaggctccggccgagtgtctcagtctg
atgaacgagtgttggaacgaggacccgagtaaaaggccgagttttgacgacgtgttcaaa
cagtttcggggcatcaacagagggaagagggcgaacatcatcgactcgatgctgcggatg
ttggagcagtacagttcaaacctggaggatctgatccgagaacgaacggacgaactggag
gtcgagagaaacaagacggagaaactggtcggacagctgcttccaaagtctgtggctcag
gctctgaagaaagggaaaccggttcaacctgaacattattcagactccactctttacttc
agtgacatcgttggatttacgaccatctcagcgctcagtgaacccatcgaggtggtcgac
ctgctgaacgacctctacaccatgtttgatgccatcattgcttctcatgacgtctacaag
gtagagaccatcggagacgcctacatggtggcttcaggcgtccccaacaggaatgggact
cgacacgcagctgaagttgccaacatgtctctggacatcctgcactcgatcggagccttt
aagatcaaacacatgcctgagatcaaagtcaagatccgcatcggactgcactcaggtccg
gttgtagcaggtgtggtcggcctcacgatgcccaggtattgtctgtttggagacacggtg
acgacggcgtcgcacatggaagctacaggactgccctacagaatccacatcagtctgagc
acagtgaaggtcctgaccagtctcaaactgggataccactttgacaccaggaaggcacag
gtgaagggttcagaggacacgtactggctgatcagtcgagatggattcagcaaacctctt
cctgttcctccagacctcactggaggggccagtaaccatgggatcagtctggatgagatt
ccagttgagagacgacaaaaatttctggatcgacagaagaaaacaaagaaatga

DBGET integrated database retrieval system