KEGG   Lates calcarifer (barramundi perch): 108882838Help
Entry
108882838         CDS       T04895                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf00480  Glutathione metabolism
lcf00590  Arachidonic acid metabolism
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    108882838 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108882838 (gpx3)
Enzymes [BR:lcf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     108882838 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 108882838
NCBI-ProteinID: XP_018531086
Position
Unknown
AA seq 220 aa AA seqDB search
MWPLLPLLLLGLLRPCAAETAFTQRCDSSTDGTIYKYHAKTLNGSHTVNLSDYRGRSVLF
VNVATYUGFTFQYVELNALHEEMKPLGLTILGFPCNQFGKQEPGQKHEILPGLKHVRPGN
GFVPNFLLFEKGDVNGKDEQEVFTYLKNSCPPVGDSFGNTANRLFWEPLKTSDIKWNFEK
FLVGPDGKPVMRWHPTVNISGVRADIHKYLLQRYTQDFFN
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccctcttaccgctgctgctgctcggtctgctgagaccctgcgccgccgaaacc
gccttcacacagcgctgtgactcatccacagatggcaccatttacaaataccatgcaaag
actctgaacgggagtcacactgtgaacctcagtgactacagaggcaggagcgtccttttt
gtcaatgtggcaacatactgaggattcacctttcagtatgtggaactgaatgcactacat
gaggagatgaaaccacttggactcaccattcttggctttccctgcaaccagtttgggaaa
caggaaccggggcaaaaacatgaaatcctgccaggtttaaagcatgtcagaccagggaat
ggatttgttccaaacttcctgctgtttgagaaaggtgatgtgaatggaaaagatgagcaa
gaggttttcacttacctcaagaactcctgccctccagttggagacagctttggtaatact
gccaacagattgttctgggagcctctgaagaccagcgacattaagtggaactttgagaag
tttctggtgggaccagacgggaagcctgtgatgaggtggcacccaaccgtcaacatttcg
ggggtccgagctgacattcacaaatacctgctccagcgctacacacaggatttttttaat
tag

DBGET integrated database retrieval system