KEGG   Lates calcarifer (barramundi perch): 108882906Help
Entry
108882906         CDS       T04895                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
lcf  Lates calcarifer (barramundi perch)
Pathway
lcf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lcf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    108882906
Enzymes [BR:lcf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     108882906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 108882906
NCBI-ProteinID: XP_018531212
Position
Unknown
AA seq 495 aa AA seqDB search
MISTLQKSIRQMWAVRGLHKSAIEVLKRPAPEDTVTASFGKFISEIKAQHLSSLVLYRSK
RMVLDSIGVGLIGSTTDVFELALQHCQHMYAPDDISSVYGRRGTRLSPTLAAFVNGVATH
SMDFDDTWHPATHPSGAVLPAVLALSDMMPANSKPSGLDFLLAFNIGIEIQGRLMRFSNE
AHNIPKRFHPPTVVGTMGSAAACARLLSLNNSQCSHALAIAASLSGAPMANAATQSKPLH
IGNAARLGLEAALLASRGLEASPLVLDTVAGVAGFNAFYEDYVPQPLESPNDDGHMFLLE
EQDMGFKRFPAHLGMHWVADAAASVHKLLVGVGPGTVSPAQVQDIQLRVPKSKYINRPFP
ESEHEARHSFQFNACSALLDGEVTVQSFTPAAMSRPELLTLLSRVRVENPHDNPANFNHM
YGEVQVTLVGGDILKGRCDTFYGHWRNPLTNESLRKKFRNNAGVVLPSEKVERLIDVVEE
LDRIGDCRALLSQLQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatctccacactgcagaaaagcattagacaaatgtgggctgtcagaggactgcacaag
tcagcaattgaagttctgaagcgcccggccccagaggacacagtcacagccagctttggg
aagttcatcagtgaaataaaagcccagcatttgtcctccttagtcctctaccgcagcaaa
aggatggtgctggacagcattggggttggcctgattggcagcacgacagacgtgtttgaa
ctggccctgcagcactgccagcacatgtatgctccagacgacatcagctctgtttatgga
cgcaggggcaccagactctccccaacactggcagcctttgtcaatggagtggcgactcac
tccatggactttgatgatacgtggcaccctgccactcatccctcaggagcagtccttcct
gctgtgttagcacttagtgacatgatgcccgctaacagcaaacccagtggcctggacttc
ctgctggctttcaacattggcatcgagatccagggtcgactaatgaggttctctaacgaa
gcccacaacatccccaagaggtttcaccctccaactgtggtggggacaatgggaagtgca
gcagcttgtgctcgcctcttgtctttaaataactcccagtgcagtcatgcattggccata
gctgcttctctatctggagcaccaatggctaatgctgccactcagtctaaacccctccac
atcggcaatgctgcacgtctgggactggaggctgctctgctggcctcccgaggcctagag
gcaagccccctggtcctagatactgtcgcaggagtggctggcttcaatgctttttatgaa
gactatgtgccacagcctttagagtcacccaatgatgacggccacatgttcctgctagag
gagcaggacatgggcttcaagcgcttcccagcccatctgggaatgcactgggtggcagat
gccgcagcctcagtccataagcttcttgtgggagtcggccccgggaccgtctccccagct
caagtccaggacatccagctcagagtccccaagtcaaagtacatcaacaggcctttccct
gagtctgagcatgaggcacgccactccttccagttcaatgcttgcagcgccctcctggac
ggcgaggtgactgtgcagtccttcactcctgctgccatgagccgccccgagctgctcacc
ctgctaagccgcgttcgcgtggagaatccccacgacaacccagctaatttcaaccacatg
tatggcgaagtccaagtgacacttgttgggggagacattctgaagggacgctgtgacacc
ttctatggtcactggcgcaacccactgaccaatgagagcctgaggaagaagttcagaaac
aacgcaggggtggtgctgccctcagagaaggttgagaggttgattgatgtggtggaggag
ctggacagaattggagactgcagggcccttctttcacagctgcaatga

DBGET integrated database retrieval system